| Primary information |
|---|
| sequence ID | Seq_7721 |
| Peptide sequence | SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAKSRPV |
| CancerPDF_ID | CancerPDF_ID20, CancerPDF_ID8424, CancerPDF_ID8523, CancerPDF_ID11052, |
| PMID | 16896061,23667664,23667664,26993605 |
| Protein Name | Fibrinogen alpha chain,Fibrinogen alpha,Fibrinogen alpha,Fibrinogen alpha chain |
| UniprotKB Entry Name | FIBA_HUMAN,FIBA_HUMAN,FIBA_HUMAN,FIBA_HUMAN |
| Fluid | Serum,Serum,Serum,Serum |
| M/Z | 5901.7,5905.24,5900.7,5900 |
| Charge | 1,1,1,NA |
| Mass (in Da) | 5901.67,NA,5905.24,NA |
| fdr | NA,NA,NA,NA |
| Profiling Technique | MALDI-TOF,MALDI-TOF,MALDI-TOF,MALDI-TOF |
| Peptide Identification technique | Q/TOF MS/MS,FT-ICR MS/MS + nano-HPLC,FT-ICR MS/MS + nano-HPLC,LTQ-Orbitrap-MS/MS |
| Quantification Technique | NA,NA,NA,NA |
| Labelled/Label Free | Label Free,Label Free,Label Free,Label Free |
| FDR | NA,NA,NA,less than 0.000002 |
| CancerPDF_ID | CancerPDF_ID20, CancerPDF_ID8424, CancerPDF_ID8523, CancerPDF_ID11052, |
| p-Value | 1.00E-05,NA,NA,less than 0.05 |
| Software | MASCOT,MASCOT,MASCOT,SEQUEST |
| Length | 54,54,54,54 |
| Cancer Type | Metastatic thyroid carcinomas,"Breast cancer, Lung cancer, Rectal cancer","Breast cancer, Lung cancer, Rectal cancer",Esophageal squamous cell carcinoma (ESCC) |
| Database | NCBI refseq Protein Database,NA,NA,IPI Human Database (3.45) |
| Modification | NA,NA,NA,NA |
| Number of Patients | 40 metastatic thyroid carcinoma patients and 40 normal for training phase and 10 metastatic thyroid carcinoma and 10 normal individuals for independent validation,"Breast Cancer =84, lung cancer= 70, Rectal cancer = 30patients; 500 healthy","Breast Cancer =84, lung cancer= 70, Rectal cancer = 30patients; 500 healthy",for training 100 ESCC patients and 98 healthy individuals were used and for validation 101 ESCC patients and 98 healthy individuals were used |
| Regulation | Differentially expressed between cancer vs normal samples,Frequency of peptide In lung cancer : 78.57% ; In Rectal cancer : 86.11% ; Breast cancer: 72%; In normal healthy individuals : 80.6%,NA,Upregulated in patients vs normal with mean intensity 100.55 in normal and 831.12 in cancer |
| Validation | Independent validation,NA,NA,external cross validation done |
| Sensitivity | 95% on independent dataset,NA,NA,97% on training dataset and 97.3 on validation dataset |
| Specificity | 95% on independent dataset,NA,NA,95.92% on training dataset and 100% on validation dataset |
| Accuracy | NA,NA,NA,NA |
| Peptide Atlas | NA |
| IEDB | |