Primary information |
---|
sequence ID | Seq_6748 |
Peptide sequence | RTGEVGAVGPPGFAGEKGPSGEAGTAGPPGTPGPQG |
CancerPDF_ID | CancerPDF_ID11007, CancerPDF_ID11009, |
PMID | 21805675,21805675 |
Protein Name | Collagen alpha-2(I) chain,Collagen alpha-2(I) chain |
UniprotKB Entry Name | CO1A2_HUMAN,CO1A2_HUMAN |
Fluid | Urine,Urine |
M/Z | 3249.5368,3265.5277 |
Charge | NA,NA |
Mass (in Da) | NA,NA |
fdr | NA,NA |
Profiling Technique | MALDI-TOF,MALDI-TOF |
Peptide Identification technique | MALDI-TOF-MS,MALDI-TOF-MS |
Quantification Technique | NA,NA |
Labelled/Label Free | Label Free,Label Free |
FDR | 1,1 |
CancerPDF_ID | CancerPDF_ID11007, CancerPDF_ID11009, |
p-Value | NA,NA |
Software | NA,NA |
Length | 36,36 |
Cancer Type | Muscle-invasive bladder cancer,Muscle-invasive bladder cancer |
Database | SwissProt Database,SwissProt Database |
Modification | "Oxidation: 10, 32, 34","Oxidation: 10, 29, 32, 34" |
Number of Patients | 751 bladder cancer and 127 control,751 bladder cancer and 127 control |
Regulation | Differentially expressed between cancer vs normal samples,Differentially expressed between cancer vs normal samples |
Validation | Mann-Whitney tests and areas under receiver-operator characteristic,Mann-Whitney tests and areas under receiver-operator characteristic |
Sensitivity | NA,NA |
Specificity | NA,NA |
Accuracy | NA,NA |
Peptide Atlas | NA |
IEDB | |