Primary information |
---|
sequence ID | Seq_6562 |
Peptide sequence | RGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGR |
CancerPDF_ID | CancerPDF_ID3956, CancerPDF_ID3963, |
PMID | 22809520,22809520 |
Protein Name | Submaxillary gland androgen-regulated protein 3B,Submaxillary gland androgen-regulated protein 3B |
UniprotKB Entry Name | SMR3B_HUMAN,SMR3B_HUMAN |
Fluid | Saliva,Saliva |
M/Z | NA,NA |
Charge | NA,NA |
Mass (in Da) | NA,NA |
fdr | 3561.91,3561.91 |
Profiling Technique | LC-MS and iTRAQ,LC-MS and iTRAQ |
Peptide Identification technique | MS/MS,MS/MS |
Quantification Technique | "2,4,6-trinitrobenzenesulfonic acid assay","2,4,6-trinitrobenzenesulfonic acid assay" |
Labelled/Label Free | Labelled,Labelled |
FDR | NA,NA |
CancerPDF_ID | CancerPDF_ID3956, CancerPDF_ID3963, |
p-Value | NA,NA |
Software | MASCOT (v2.1.1),MASCOT (v2.1.1) |
Length | 32,32 |
Cancer Type | Normal,Normal |
Database | SwissProt Database (release date 010111),SwissProt Database (release date 010111) |
Modification | iTRAQ8plexatN-term,iTRAQ8plexatN-term |
Number of Patients | NA,NA |
Regulation | NA,NA |
Validation | NA,NA |
Sensitivity | NA,NA |
Specificity | NA,NA |
Accuracy | NA,NA |
Peptide Atlas | PeptideAtlas |
IEDB | |