| Primary information |
|---|
| sequence ID | Seq_6420 |
| Peptide sequence | QTPKHISESLGAEVDPDMSWSSSLATPPTLSSTVLIGLLHSSVK |
| CancerPDF_ID | CancerPDF_ID3402, |
| PMID | 24565027 |
| Protein Name | Breast cancer type 2 susceptibility protein |
| UniprotKB Entry Name | BRCA2_HUMAN |
| Fluid | Plasma |
| Profiling Technique | Linear ion-trap mass spectrometer (LTQ) coupled with a Surveyor HPLC-MS |
| Peptide Identification technique | MS/MS |
| Labelled/Label Free | Label Free |
| FDR | 0.05 |
| CancerPDF_ID | CancerPDF_ID3402, |
| p-Value | less than 0.05 |
| Software | SEQUEST and OMSSA |
| Length | 44 |
| Cancer Type | Breast cancer |
| Database | SASD (Synthetic Alternative Splicing Database) |
| Modification | NA |
| Number of Patients | 40 cancer patients for each training and testing set; 40 normal individuals for each training and testing set |
| Regulation | Differentially expressed between normal and patients |
| Validation | Independent validation |
| Sensitivity | NA |
| Specificity | NA |
| Accuracy | NA |
| Peptide Atlas | NA |
| IEDB | NA |