| Primary information |
|---|
| sequence ID | Seq_5454 |
| Peptide sequence | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA |
| CancerPDF_ID | CancerPDF_ID8650, |
| PMID | 19762145 |
| Protein Name | Macrophage migration inhibitory protein |
| UniprotKB Entry Name | MIF_HUMAN |
| Fluid | Serum |
| Charge | 1 |
| Profiling Technique | FPLC |
| Peptide Identification technique | LC-MS |
| Labelled/Label Free | Label Free |
| CancerPDF_ID | CancerPDF_ID8650, |
| p-Value | 0.05 |
| Software | ABI Analyst version 1.1 and MASCOT |
| Length | 113 |
| Cancer Type | Bladder cancer |
| Database | NCBI |
| Modification | NA |
| Number of Patients | 50 patient with bladder cancer and 50 normal person for comparison |
| Regulation | NA |
| Validation | NA |
| Sensitivity | NA |
| Specificity | NA |
| Accuracy | NA |
| Peptide Atlas | NA |
| IEDB | NA |