Primary information |
---|
sequence ID | Seq_4486 |
Peptide sequence | KVQWKVDNALQSGNSQESVTEQDSKDSTYSL |
CancerPDF_ID | CancerPDF_ID5652, CancerPDF_ID5653, CancerPDF_ID5654, CancerPDF_ID5655, |
PMID | 24982608,24982608,24982608,24982608 |
Protein Name | Ig kappa chain C region,IGKat protein,IGKat protein,Putative uncharacterized protein IGKC |
UniprotKB Entry Name | IGKC_HUMAN,Q6PJF2_HUMAN,Q6PJF2_HUMAN,NA |
Fluid | Urine,Urine,Urine,Urine |
M/Z | NA,NA,NA,NA |
Charge | NA,NA,NA,NA |
Mass (in Da) | NA,NA,NA,NA |
fdr | NA,NA,NA,NA |
Profiling Technique | Nano-LC-MS,Nano-LC-MS,Nano-LC-MS,Nano-LC-MS |
Peptide Identification technique | MS/MS,MS/MS,MS/MS,MS/MS |
Quantification Technique | NA,NA,NA,NA |
Labelled/Label Free | Label Free,Label Free,Label Free,Label Free |
FDR | 0.01,0.01,0.01,0.01 |
CancerPDF_ID | CancerPDF_ID5652, CancerPDF_ID5653, CancerPDF_ID5654, CancerPDF_ID5655, |
p-Value | NA,NA,NA,NA |
Software | "GPM search engine, MASCOT","GPM search engine, MASCOT","GPM search engine, MASCOT","GPM search engine, MASCOT" |
Length | 29,29,29,29 |
Cancer Type | Ovarian cancer,Ovarian cancer,Ovarian cancer,Ovarian cancer |
Database | IPI 3.71 Human Database ,IPI 3.71 Human Database ,IPI 3.71 Human Database ,IPI 3.71 Human Database |
Modification | NA,NA,NA,NA |
Number of Patients | 6 Ovarian cancer patients and 6 normal individuals,6 Ovarian cancer patients and 6 normal individuals,6 Ovarian cancer patients and 6 normal individuals,6 Ovarian cancer patients and 6 normal individuals |
Regulation | Uniquely present in case of urine of ovarian cancer patients,Uniquely present in case of urine of ovarian cancer patients,Uniquely present in case of urine of ovarian cancer patients,Uniquely present in case of urine of ovarian cancer patients |
Validation | NA,NA,NA,NA |
Sensitivity | NA,NA,NA,NA |
Specificity | NA,NA,NA,NA |
Accuracy | NA,NA,NA,NA |
Peptide Atlas | NA |
IEDB | |