| Primary information |
|---|
| sequence ID | Seq_1644 |
| Peptide sequence | EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES |
| CancerPDF_ID | CancerPDF_ID12851, |
| PMID | 23915341 |
| Protein Name | Platelet factor 4 |
| UniprotKB Entry Name | PLF4_HUMAN |
| Fluid | Serum |
| fdr | 7762.87 |
| Profiling Technique | MALDI-TOF |
| Peptide Identification technique | LC/ESI MS-MS |
| Labelled/Label Free | Label Free |
| CancerPDF_ID | CancerPDF_ID12851, |
| p-Value | 1.08E-06 |
| Software | Bioworks Browser |
| Length | 70 |
| Cancer Type | Acute myeloid leukemia (AML) |
| Database | IPI Human Database ( v3.45 ) |
| Modification | NA |
| Number of Patients | "72 healthy controls were selected from adult healthy examinees without any diseases. In addition, 37 serum samples were obtained from AML patients with hematologic CR and 30 serum samples from refractory & relapsed AML patients." |
| Regulation | Downregulated in AML vs healthy |
| Validation | NA |
| Sensitivity | NA |
| Specificity | NA |
| Accuracy | NA |
| Peptide Atlas | NA |
| IEDB | NA |