| Primary information |
|---|
| sequence ID | Seq_990 |
| Peptide sequence | AWKADSSPVKAGVETTTPSKQSNNKYAASSY |
| CancerPDF_ID | CancerPDF_ID4430, CancerPDF_ID4431, CancerPDF_ID4432, CancerPDF_ID10696, |
| PMID | 24982608,24982608,24982608,21805675 |
| Protein Name | hypothetical protein XP_002348153,IGLat protein,IGLat protein,Ig lambda chain C regions |
| UniprotKB Entry Name | NA,Q8N355_HUMAN,Q8N355_HUMAN,LAC_HUMAN |
| Fluid | Urine,Urine,Urine,Urine |
| M/Z | NA,NA,NA,3273.6064 |
| Charge | NA,NA,NA,NA |
| Mass (in Da) | NA,NA,NA,NA |
| fdr | NA,NA,NA,NA |
| Profiling Technique | Nano-LC-MS,Nano-LC-MS,Nano-LC-MS,MALDI-TOF |
| Peptide Identification technique | MS/MS,MS/MS,MS/MS,MALDI-TOF-MS |
| Quantification Technique | NA,NA,NA,NA |
| Labelled/Label Free | Label Free,Label Free,Label Free,Label Free |
| FDR | 0.01,0.01,0.01,1 |
| CancerPDF_ID | CancerPDF_ID4430, CancerPDF_ID4431, CancerPDF_ID4432, CancerPDF_ID10696, |
| p-Value | NA,NA,NA,NA |
| Software | "GPM search engine, MASCOT","GPM search engine, MASCOT","GPM search engine, MASCOT",NA |
| Length | 31,31,31,31 |
| Cancer Type | Ovarian cancer,Ovarian cancer,Ovarian cancer,Muscle-invasive bladder cancer |
| Database | IPI 3.71 Human Database ,IPI 3.71 Human Database ,IPI 3.71 Human Database ,SwissProt Database |
| Modification | NA,NA,NA,NA |
| Number of Patients | 6 Ovarian cancer patients and 6 normal individuals,6 Ovarian cancer patients and 6 normal individuals,6 Ovarian cancer patients and 6 normal individuals,751 bladder cancer and 127 control |
| Regulation | Uniquely present in case of urine of ovarian cancer patients,Uniquely present in case of urine of ovarian cancer patients,Uniquely present in case of urine of ovarian cancer patients,Differentially expressed between cancer vs normal samples |
| Validation | NA,NA,NA,Mann-Whitney tests and areas under receiver-operator characteristic |
| Sensitivity | NA,NA,NA,NA |
| Specificity | NA,NA,NA,NA |
| Accuracy | NA,NA,NA,NA |
| Peptide Atlas | NA |
| IEDB | |