| Primary information |
|---|
| sequence ID | Seq_610 |
| Peptide sequence | ANDESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN |
| CancerPDF_ID | CancerPDF_ID8648, |
| PMID | 19674866 |
| Protein Name | Osteopontin ( C terminal fragment of protein OPN) |
| UniprotKB Entry Name | OSTP_HUMAN |
| Fluid | Cerbrospinal fluid |
| Charge | 1 |
| Profiling Technique | MALDI-TOF |
| Peptide Identification technique | nanoESI-qTOF-MS/MS |
| Quantification Technique | Q/TOF/MS |
| Labelled/Label Free | Label Free |
| CancerPDF_ID | CancerPDF_ID8648, |
| p-Value | 0.05 |
| Software | MASCOT |
| Length | 65 |
| Cancer Type | Glioblastoma (Malignant brain tumor) |
| Database | SwissProt Database and MSDB. |
| Modification | NA |
| Number of Patients | 11 patient with glioblastoma |
| Regulation | Upregulated in cancer as compare to normal control |
| Validation | NA |
| Sensitivity | NA |
| Specificity | NA |
| Accuracy | NA |
| Peptide Atlas | NA |
| IEDB | NA |