Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID20 | SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Serum | 5901.7 | MALDI-TOF | Metastatic thyroid carcinomas | Differentially expressed between cancer vs normal samples | 16896061 |
| CancerPDF_ID958 | NA | NA | Serum | 5907.39 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID976 | NA | NA | Serum | 5338.71 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID990 | NA | NA | Serum | 5868.38 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1005 | NA | NA | Serum | 5755.96 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1007 | NA | NA | Serum | 5636.48 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1016 | NA | NA | Serum | 5066.24 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1104 | NA | NA | Serum | 5305 | MALDI-TOF | Pancreatic cancer | Differentially expressed between cancer vs normal | 19470732 |
| CancerPDF_ID1125 | NA | NA | Serum | 5907 | MALDI-TOF | Pancreatic cancer | Differentially expressed between cancer vs normal | 19470732 |
| CancerPDF_ID1130 | NA | NA | Serum | 5837 | MALDI-TOF | Pancreatic cancer | Differentially expressed between cancer vs normal | 19470732 |
| CancerPDF_ID1131 | NA | NA | Serum | 5959 | MALDI-TOF | Pancreatic cancer | Differentially expressed between cancer vs normal and considered as signature ion | 19470732 |
| CancerPDF_ID1150 | NA | NA | Serum | 5907 | MALDI-TOF | Pancreatic cancer | Differentially expressed between cancer vs normal | 19470732 |
| CancerPDF_ID1155 | NA | NA | Serum | 5837 | MALDI-TOF | Pancreatic cancer | Differentially expressed between cancer vs normal | 19470732 |
| CancerPDF_ID1179 | NA | NA | Serum | 5248.05 | MALDI-TOF | Lung cancer | Upregulated in cancer vs normal with average expression of peptide in cancer 1.38 and in normal 1.02 | 21082738 |
| CancerPDF_ID1180 | NA | NA | Serum | 5079.93 | MALDI-TOF | Lung cancer | Upregulated in cancer vs normal with average expression of peptide in cancer 1.4 and in normal 0.89 | 21082738 |
| CancerPDF_ID1186 | NA | NA | Serum | 5293.03 | MALDI-TOF | Lung cancer | Upregulated in cancer vs normal with average expression of peptide in cancer 1.52 and in normal 0.91 | 21082738 |
| CancerPDF_ID1474 | EGVQKEDIPPADLSDQVPDTESETRILLQGTPVAQMTEDAVDAERL | Complement C3 | Serum | 5005.43501 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID3263 | NA | NA | Serum | 5752 | MALDI-TOF | Stomach adenocarcinoma | NA | 21267442 |
| CancerPDF_ID3264 | NA | Fibrinogen alpha-chain fragment | Serum | 5902 | MALDI-TOF | Stomach adenocarcinoma | Differentially expressed in cancer patients as cpmpare to normal | 21267442 |
| CancerPDF_ID3273 | NA | NA | Serum | 5341 | MALDI-TOF | Ovarian cancer | Differentially expressed between normal and patients | 22086897 |
| CancerPDF_ID3274 | NA | NA | Serum | 5909.2 | MALDI-TOF | Ovarian cancer | Differentially expressed between normal and patients | 22086897 |
| CancerPDF_ID3288 | NA | NA | Serum | 5007.8 | MALDI-TOF | Ovarian cancer | Differentially expressed between normal and patients | 22086897 |
| CancerPDF_ID3308 | NA | NA | Serum | 5583.3 | MALDI-TOF | Ovarian cancer | Differentially expressed between normal and patients | 22086897 |
| CancerPDF_ID3352 | NA | NA | Serum | 5292.77 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3353 | NA | NA | Serum | 5079.68 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3365 | NA | NA | Serum | 5264.02 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3378 | NA | NA | Serum | 5753.12 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3396 | NA | NA | Serum | 5247.81 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3397 | NA | NA | Serum | 5336.3 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID8424 | SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha | Serum | 5905.24 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 78.57% ; In Rectal cancer : 86.11% ; Breast cancer: 72%; In normal healthy individuals : 80.6% | 23667664 |
| CancerPDF_ID8475 | NA | NA | Serum | 5319.96 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide in normal healthy : 23% | 23667664 |
| CancerPDF_ID8486 | NA | NA | Serum | 5000.21 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide in lung cancer : 30% ; In breast cancer: 37%; In normal healthy individuals : 7% | 23667664 |
| CancerPDF_ID8488 | NA | NA | Serum | 5282.44 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | "Frequency of peptide in rectal cancer : 66.67% , In normal healthy individuals : 1.2%" | 23667664 |
| CancerPDF_ID8497 | NA | NA | Serum | 5291.71 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | "Frequency of peptide in breast cancer : 64% , In normal healthy individuals : 0.4%" | 23667664 |
| CancerPDF_ID8522 | SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHA | Fibrinogen alpha | Serum | 5333.35 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8523 | SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha | Serum | 5900.7 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8656 | NA | NA | Serum | 5247.62 | MALDI-TOF | "Hepatocellular carcinoma, Liver cirrhosis, Chronic hepatitis" | significantly different from that of normal | 23915185 |
| CancerPDF_ID8662 | NA | NA | Serum | 5064.37 | MALDI-TOF | "Hepatocellular carcinoma, Liver cirrhosis, Chronic hepatitis" | significantly different from that of normal | 23915185 |
| CancerPDF_ID8664 | NA | NA | Serum | 5805.51 | MALDI-TOF | "Hepatocellular carcinoma, Liver cirrhosis, Chronic hepatitis" | significantly different from that of normal | 23915185 |
| CancerPDF_ID11035 | IHTGENPYECSECGKAFRYSSALVRHQRIHTGEKPLNGIGMSKSSLRVTTELN | zinc finger protein 3 | Serum | 5905.23 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11041 | NA | NA | Serum | 5752.25 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11042 | NA | NA | Serum | 5724.76 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11043 | NA | NA | Serum | 5844.36 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11044 | NA | NA | Serum | 5739.69 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11045 | NA | NA | Serum | 5818.83 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11052 | SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Serum | 5900 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Upregulated in patients vs normal with mean intensity 100.55 in normal and 831.12 in cancer | 26993605 |
| CancerPDF_ID11061 | NA | NA | Serum | 5924.6 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Upregulated in ESCC patients vs control with mean intensity in cancer as 425.63 and mean intensity in normal as 50.61 | 26993605 |
| CancerPDF_ID11062 | NA | NA | Serum | 5910 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Upregulated in ESCC patients vs control with mean intensity in cancer as 739.57 and mean intensity in normal as 87.40 | 26993605 |
| CancerPDF_ID11063 | NA | NA | Serum | 5882.1 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Upregulated in ESCC patients vs control with mean intensity in cancer as 681.97 and mean intensity in normal as 114.65 | 26993605 |
| CancerPDF_ID11073 | SSSYSKQFTSST SYNRGDSTFESKSYKMADEAGSEADHEGTH STKRGHAKSR | Fibrinogen alpha chain | Blood | 5910 | MALDI-TOF | Gastric cancer | Upregulated in gastric patients vs healthy with 45.5±13.1 intesity in cancer patients and 9.2±4.7 intensity in normal pateints | 26662807 |
| CancerPDF_ID11108 | NA | NA | Urine | 5514.2 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in pT1b compared to pT1a patients | 26482227 |
| CancerPDF_ID11117 | NA | NA | Urine | 5004.4 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in grade vs normal | 26482227 |
| CancerPDF_ID11118 | NA | NA | Urine | 5027.8 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in grade vs normal | 26482227 |
| CancerPDF_ID11119 | NA | NA | Urine | 5043.6 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in grade vs normal | 26482227 |
| CancerPDF_ID11120 | NA | NA | Urine | 5231.5 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in grade vs normal | 26482227 |
| CancerPDF_ID11131 | NA | NA | Urine | 5231.5 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID11132 | NA | NA | Urine | 5578.2 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID12767 | NA | NA | Serum | 5893.8 | MALDI-TOF | Cervical cancer | Upregulated in Cervical squamous cell carcinoma vs healthy | 26282206 |
| CancerPDF_ID12774 | NA | NA | Serum | 5027.39 | MALDI-TOF | Hepatocellular carcinoma | Downregulated in cancer vs Healthy | 25910294 |
| CancerPDF_ID12789 | NA | NA | Serum | 5917.99 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12791 | NA | NA | Serum | 5906.51 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12809 | NA | NA | Serum | 5343.62 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12810 | NA | NA | Serum | 5338.47 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12841 | NA | NA | Serum | 5073.04 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID14267 | NA | NA | Serum | 5008.32 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14268 | NA | NA | Serum | 5022.55 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14269 | NA | NA | Serum | 5026.15 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14270 | NA | NA | Serum | 5032.97 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14271 | NA | NA | Serum | 5049.86 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14272 | NA | NA | Serum | 5149.58 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14273 | NA | NA | Serum | 5163.83 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14274 | NA | NA | Serum | 5174.29 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14275 | NA | NA | Serum | 5320.45 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14276 | NA | NA | Serum | 5327.39 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14277 | NA | NA | Serum | 5339.21 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14278 | NA | NA | Serum | 5346.44 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14279 | NA | NA | Serum | 5352.7 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14280 | NA | NA | Serum | 5358.43 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14281 | NA | NA | Serum | 5858.57 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14282 | NA | NA | Serum | 5862.99 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14283 | NA | NA | Serum | 5869.26 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14284 | NA | NA | Serum | 5875.44 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14285 | NA | NA | Serum | 5880.54 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14286 | NA | NA | Serum | 5881.57 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14287 | NA | NA | Serum | 5888.05 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14288 | NA | NA | Serum | 5893.17 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14289 | NA | NA | Serum | 5895.44 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14290 | NA | NA | Serum | 5903.45 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14291 | NA | NA | Serum | 5916.57 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14292 | NA | NA | Serum | 5922.78 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14293 | NA | NA | Serum | 5924.43 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14294 | NA | NA | Serum | 5925.4 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14295 | NA | NA | Serum | 5931.69 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14296 | NA | NA | Serum | 5943.94 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14330 | NA | NA | Serum | 5263.98 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14354 | NA | NA | Serum | 5963.91 | IMAC-MB | Breast cancer | NA | 22521044 |
| CancerPDF_ID14357 | NA | NA | Serum | 5247.62 | MB-WCX | Hepatocellular carcinoma | NA | 23915185 |
| CancerPDF_ID14363 | NA | NA | Serum | 5064.37 | MB-WCX | Hepatocellular carcinoma | NA | 23915185 |
| CancerPDF_ID14365 | NA | NA | Serum | 5805.51 | MB-WCX | Hepatocellular carcinoma | NA | 23915185 |