Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID15 | SSSYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha chain | Serum | 3190.4 | MALDI-TOF | Metastatic thyroid carcinomas | Differentially expressed between cancer vs normal samples | 16896061 |
| CancerPDF_ID16 | SSSYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha chain | Serum | 3261.4 | MALDI-TOF | Metastatic thyroid carcinomas | Differentially expressed between cancer vs normal samples | 16896061 |
| CancerPDF_ID18 | NA | Fibrinogen alpha chain | Serum | 3206.34 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID19 | NA | Fibrinogen alpha chain | Serum | 3277.39 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID22 | SYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Serum | 3239.22 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID42 | GLEEELQFSLGSKINVKVGGNSKGTLKVLR | Complement C4 precursor | Serum | 3200.52 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID55 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H13 | Serum | 3272.5 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID56 | QAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H14 | Serum | 3970.97 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID59 | NVHSGSTFFKYYLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H17 | Serum | 3156.52 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID71 | QGLLPVLESFKVSFLSALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 3182.46 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID77 | AELQEGARQKLHELQEKLSPLGEEMRDRA | Apolipoprotein A-I | Serum | 3377.45 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID204 | NVHSGSTFFKYYLQGAKIPKPEASFSPR | inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 3156.6207 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS | 19728888 |
| CancerPDF_ID232 | NA | NA | Serum | 3427.8221 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID241 | VLSPADKTNVKAAWGKVGAHAGEYGAEALERM | Hemoglobin alpha | Serum | 3326.6863 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Signature peptide that can Differentiate between NSCLC patients and healthy volunteers | 19728888 |
| CancerPDF_ID243 | VLSPADKTNVKAAWGKVGAHAGEYGAEALERMF | Hemoglobin alpha | Serum | 3473.7545 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Signature peptide that can Differentiate between NSCLC patients and healthy volunteers | 19728888 |
| CancerPDF_ID249 | NVHSGSTFFKYYLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 3156.6207 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID266 | NA | NA | Serum | 3215.1939 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients with a partial response versus patients with stable or progressive disease | 19728888 |
| CancerPDF_ID975 | NA | NA | Serum | 3241.4 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID979 | NA | NA | Serum | 3952.53 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID983 | NA | NA | Serum | 3263.36 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID984 | NA | NA | Serum | 3883.56 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID991 | NA | NA | Serum | 3192.38 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1001 | NA | NA | Serum | 3935.5 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1012 | NA | NA | Serum | 3316.26 | MALDI-TOF | Colorectal cancer | Downregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1032 | SSSYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha chain | Serum | 3190.4 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.52, 0 and 0.94 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1033 | SSSYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha chain | Serum | 3261.4 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.33, 0.08 and 0.74 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1035 | NA | Fibrinogen alpha chain | Serum | 3206.34 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1036 | NA | Fibrinogen alpha chain | Serum | 3277.39 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1038 | SYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Serum | 3239.22 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1057 | GLEEELQFSLGSKINVKVGGNSKGTLKVLR | Complement C4 precursor | Serum | 3200.52 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1066 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H11 | Serum | 3272.5 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1, 1277 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1067 | QAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H12 | Serum | 3970.97 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1, 957 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1070 | NVHSGSTFFKYYLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H15 | Serum | 3156.52 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =3.43, 10.68 and 1.33 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1073 | QGLLPVLESFKVSFLSALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 3182.46 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =0.74, 6.36 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1076 | AELQEGARQKLHELQEKLSPLGEEMRDRA | Apolipoprotein A-I | Serum | 3377.45 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1109 | NA | NA | Serum | 3215 | MALDI-TOF | Pancreatic cancer | Differentially expressed between cancer vs normal | 19470732 |
| CancerPDF_ID1111 | NA | Platelet factor 4 | Serum | 3884 | MALDI-TOF | Pancreatic cancer | Differentially expressed between cancer vs normal and considered as signature ion | 19470732 |
| CancerPDF_ID1117 | NA | NA | Serum | 3158 | MALDI-TOF | Pancreatic cancer | Differentially expressed between cancer vs normal | 19470732 |
| CancerPDF_ID1121 | NA | NA | Serum | 3263 | MALDI-TOF | Pancreatic cancer | Differentially expressed between cancer vs normal | 19470732 |
| CancerPDF_ID1122 | NA | NA | Serum | 3194 | MALDI-TOF | Pancreatic cancer | Differentially expressed between cancer vs normal | 19470732 |
| CancerPDF_ID1146 | NA | NA | Serum | 3263 | MALDI-TOF | Pancreatic cancer | Differentially expressed between cancer vs normal | 19470732 |
| CancerPDF_ID1147 | NA | NA | Serum | 3194 | MALDI-TOF | Pancreatic cancer | Differentially expressed between cancer vs normal | 19470732 |
| CancerPDF_ID1159 | NA | NA | Serum | 3448 | MALDI-TOF | Pancreatic cancer | Differentially expressed between cancer vs normal | 19470732 |
| CancerPDF_ID1163 | NA | NA | Serum | 3242 | MALDI-TOF | Pancreatic cancer | Differentially expressed between cancer vs normal | 19470732 |
| CancerPDF_ID1165 | NA | NA | Serum | 3201 | MALDI-TOF | Pancreatic cancer | Differentially expressed between cancer vs normal | 19470732 |
| CancerPDF_ID1167 | NA | NA | Serum | 3972 | MALDI-TOF | Pancreatic cancer | Differentially expressed between cancer vs normal | 19470732 |
| CancerPDF_ID1171 | NA | NA | Serum | 3883.6 | MALDI-TOF | Lung cancer | Downregulated in cancer vs normal with average expression of peptide in cancer 2.78 and in normal 7.01 | 21082738 |
| CancerPDF_ID1172 | NA | NA | Serum | 3279.25 | MALDI-TOF | Lung cancer | Upregulated in cancer vs normal with average expression of peptide in cancer 4.22 and in normal 1.87 | 21082738 |
| CancerPDF_ID1175 | NA | NA | Serum | 3208.59 | MALDI-TOF | Lung cancer | Upregulated in cancer vs normal with average expression of peptide in cancer 2.57 and in normal 1.56 | 21082738 |
| CancerPDF_ID1204 | NA | NA | Serum | 3061.3 | MALDI-TOF | Lung cancer | Upregulated in cancer vs normal with average expression of peptide in cancer 3.12 and in normal 1.18 | 21082738 |
| CancerPDF_ID1265 | SSSYSKQFTSSTSYNRGDSTFESKSYK | Fibrinogen alpha | Serum | 3058.3792 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1266 | SYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha | Serum | 3086.39274 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1267 | GKSSSYSKQFTSSTSYNRGDSTFESKSY | Fibrinogen alpha | Serum | 3115.40067 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1268 | SSSYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha | Serum | 3189.41969 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1284 | SSSYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha | Serum | 3205.4146 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1285 | SSSYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha | Serum | 3260.4568 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1286 | SSSYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha | Serum | 3260.4568 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1287 | GKSSSYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha | Serum | 3374.53611 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1288 | GKSSSYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha | Serum | 3445.57323 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1301 | SYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha | Serum | 3015.35563 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1302 | SSYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha | Serum | 3102.38766 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1307 | SSYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha | Serum | 3173.42477 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1308 | SSSYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha | Serum | 3276.45172 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1338 | GGSTSYGTGSETESPRNPSSAGSWNSGSSGPGSTGNR | Fibrinogen alpha | Serum | 3516.501 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1348 | SYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha | Serum | 3238.51738 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1349 | GKSSSYSKQFTSSTSYNRGDSTFESKSYK | Fibrinogen alpha | Serum | 3243.49563 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1350 | GKSSSYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha | Serum | 3461.56814 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1395 | TLSLPELEQQQEQQQEQQQEQVQMLAPLES | Apolipoprotein A-IV | Serum | 3536.69407 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1473 | SEETKENEGFTVTAEGKGQGTLSVVTMYHAK | Complement C3 | Serum | 3327.5929 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1539 | TLDPERLGREGVQKEDIPPADLSDQVPDTESETR | Complement C3 | Serum | 3791.84497 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1603 | LAEYHAKATEHLSTLSEKAKPALEDLR | Apolipoprotein A-I | Serum | 3020.5931 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1620 | SVLGQLGITKVFSNGADLSGVTEEAPLKLS | Alpha-1 protease inhibitor | Serum | 3029.62848 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1681 | AHYDLRHTFMGVVSLGSPSGEVSHPRKT | Alpha-2-HS-glycoprotein | Serum | 3064.53012 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1717 | VSEADSSNADWVTKQLNEINYEDHKL | Complement factor B | Serum | 3004.40502 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1780 | NVQFNYPHTSVTDVTQNNFHNYFGGSEIVVAGK | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 3682.74407 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1802 | SYALTSEEAERSDGDPVQPAVLQVHQTS | Serum deprivation-response protein | Serum | 3013.42649 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1803 | YEGSYALTSEEAERSDGDPVQPAVLQVHQTS | Serum deprivation-response protein | Serum | 3362.55387 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1922 | KKEVYMPSSIFQDDFVIPDISEPGTWK | Complement C4-B | Serum | 3155.55254 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1974 | GFPRGDKLFGPDLKLVPPMEEDYPQFGSPK | Alpha-2-antiplasmin | Serum | 3360.68528 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2001 | NTQPRGPPASSPAPAPKFSPVTPKFTPVAS | Zyxin | Serum | 3030.5927 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2003 | LANTQPRGPPASSPAPAPKFSPVTPKFTPVAS | Zyxin | Serum | 3214.71388 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2004 | VSLANTQPRGPPASSPAPAPKFSPVTPKFTPVAS | Zyxin | Serum | 3400.81433 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2005 | KFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTY | Zyxin | Serum | 3737.8074 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2009 | EEIFPSPPPPPEEEGGPEAPIPPPPQPREKVS | Zyxin | Serum | 3426.69835 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2013 | FSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTY | Zyxin | Serum | 3609.71244 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2047 | TAFGGRRAVPPNNSNAAEDDLPTVELQGVVPR | Coagulation factor XIII A chain | Serum | 3346.70181 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID2064 | KSNEQATSLNTVGGTGGIGGVGGTGGVGNRAPR | Multimerin-1 | Serum | 3025.52894 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2196 | MVTGNPASDEIKRLPGDIQVVPIGVGPNANVQELER | von Willebrand factor | Serum | 3811.98907 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2198 | MVTGNPASDEIKRLPGDIQVVPIGVGPNANVQELER | von Willebrand factor | Serum | 3827.98399 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2211 | SSVDELVGIDYSLMKDPVASTSNLDMDFR | Phospholipid transfer protein | Serum | 3203.50025 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2233 | ATLGGPEEESTIENYASRPEAFNTPFLNIDKL | Protein UNQ467/PRO826 | Serum | 3522.71546 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2416 | MELERPGGNEITRGGSTSYGTGSETESPR | Fibrinogen alpha | Plasma | 3054.3949 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2417 | SSSYSKQFTSSTSYNRGDSTFESKSYK | Fibrinogen alpha | Plasma | 3058.3792 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2418 | RGFGSLNDEGEGEFWLGNDYLHLLTQR | Fibrinogen alpha | Plasma | 3122.4846 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2419 | VPPEWKALTDMPQMRMELERPGGNEIT | Fibrinogen alpha | Plasma | 3124.5144 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2420 | DSHSLTTNIMEILRGDFSSANNRDNTYN | Fibrinogen alpha | Plasma | 3184.448 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2421 | SYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha | Plasma | 3238.5174 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2422 | AFFDTASTGKTFPGFFSPMLGEFVSETESR | Fibrinogen alpha | Plasma | 3305.5227 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2423 | HRHPDEAAFFDTASTGKTFPGFFSPMLGEF | Fibrinogen alpha | Plasma | 3343.5397 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2424 | SQLQKVPPEWKALTDMPQMRMELERPGGN | Fibrinogen alpha | Plasma | 3365.6683 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2425 | GGSTSYGTGSETESPRNPSSAGSWNSGSSGPGSTGNR | Fibrinogen alpha | Plasma | 3516.501 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2426 | GGSTSYGTGSETESPRNPSSAGSWNSGSSGPGSTGNRN | Fibrinogen alpha | Plasma | 3630.5439 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2427 | SQLQKVPPEWKALTDMPQMRMELERPGGNEIT | Fibrinogen alpha | Plasma | 3708.8426 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2428 | SQLQKVPPEWKALTDMPQMRMELERPGGNEIT | Fibrinogen alpha | Plasma | 3724.8375 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2429 | SQLQKVPPEWKALTDMPQMRMELERPGGNEITR | Fibrinogen alpha | Plasma | 3864.9437 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2430 | HRHPDEAAFFDTASTGKTFPGFFSPMLGEFVSETES | Fibrinogen alpha | Plasma | 3975.805 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2431 | HRHPDEAAFFDTASTGKTFPGFFSPMLGEFVSETES | Fibrinogen alpha | Plasma | 3991.7999 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2543 | VKDLATVYVDVLKDSGRDYVSQFEGSALG | Apolipoprotein A-I | Plasma | 3130.5823 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2544 | AELQEGARQKLHELQEKLSPLGEEMRDR | Apolipoprotein A-I | Plasma | 3289.6837 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2545 | ATEHLSTLSEKAKPALEDLRQGLLPVLESF | Apolipoprotein A-I | Plasma | 3291.7715 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2546 | LREQLGPVTQEFWDNLEKETEGLRQEMS | Apolipoprotein A-I | Plasma | 3361.6249 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2547 | ATEHLSTLSEKAKPALEDLRQGLLPVLESFK | Apolipoprotein A-I | Plasma | 3419.8664 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2638 | SELTQQLNALFQDKLGEVNTYAGDLQK | Apolipoprotein A-IV | Plasma | 3022.5247 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2639 | IGDNLRELQQRLEPYADQLRTQVNTQAEQL | Apolipoprotein A-IV | Plasma | 3538.8128 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2640 | KLVPFATELHERLAKDSEKLKEEIGKELEEL | Apolipoprotein A-IV | Plasma | 3620.9665 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2641 | IGDNLRELQQRLEPYADQLRTQVNTQAEQLR | Apolipoprotein A-IV | Plasma | 3694.9139 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2642 | SLAPYAQDTQEKLNHQLEGLTFQMKKNAEELK | Apolipoprotein A-IV | Plasma | 3701.8723 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2643 | AKIDQNVEELKGRLTPYADEFKVKIDQTVEEL | Apolipoprotein A-IV | Plasma | 3717.9465 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2644 | SLAPYAQDTQEKLNHQLEGLTFQMKKNAEELKA | Apolipoprotein A-IV | Plasma | 3772.9094 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2645 | EAVEHLQKSELTQQLNALFQDKLGEVNTYAGDLQ | Apolipoprotein A-IV | Plasma | 3828.917 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2646 | AKIDQNVEELKGRLTPYADEFKVKIDQTVEELR | Apolipoprotein A-IV | Plasma | 3874.0476 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2732 | LESEETMVLEAHDAQGDVPVTVTVHDFPG | Complement C3 | Plasma | 3121.455 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2733 | SEETKENEGFTVTAEGKGQGTLSVVTMYHA | Complement C3 | Plasma | 3199.4979 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2734 | SEETKENEGFTVTAEGKGQGTLSVVTMYHA | Complement C3 | Plasma | 3215.4928 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2735 | LESEETMVLEAHDAQGDVPVTVTVHDFPGK | Complement C3 | Plasma | 3249.55 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2736 | LMNIFLKDSITTWEILAVSMSDKKGICVA | Complement C3 | Plasma | 3257.675 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2737 | SEETKENEGFTVTAEGKGQGTLSVVTMYHAK | Complement C3 | Plasma | 3327.5929 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2738 | TLDPERLGREGVQKEDIPPADLSDQVPDTESET | Complement C3 | Plasma | 3635.7439 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2739 | TLDPERLGREGVQKEDIPPADLSDQVPDTESETR | Complement C3 | Plasma | 3791.845 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2802 | GHRPLDKKREEAPSLRPAPPPISGGGYR | Fibrinogen beta chain | Plasma | 3037.6322 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2803 | TMTIHNGMFFSTYDRDNDGWLTSDPR | Fibrinogen beta chain | Plasma | 3076.3444 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2846 | GKWERPFEVKDTEEEDFHVDQVTTV | Alpha-1 protease inhibitor | Plasma | 3019.42 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2847 | SVLGQLGITKVFSNGADLSGVTEEAPLKLS | Alpha-1 protease inhibitor | Plasma | 3029.6285 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2848 | AVLTIDEKGTEAAGAMFLEAIPMSIPPEVK | Alpha-1 protease inhibitor | Plasma | 3127.6185 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2849 | SVLGQLGITKVFSNGADLSGVTEEAPLKLSK | Alpha-1 protease inhibitor | Plasma | 3157.7234 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2850 | LYHSEAFTVNFGDTEEAKKQINDYVEK | Alpha-1 protease inhibitor | Plasma | 3174.5146 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2851 | TDTSHHDQDHPTFNKITPNLAEFAFSLY | Alpha-1 protease inhibitor | Plasma | 3245.5054 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2852 | SVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVH | Alpha-1 protease inhibitor | Plasma | 3464.8879 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2853 | GKWERPFEVKDTEEEDFHVDQVTTVKVPM | Alpha-1 protease inhibitor | Plasma | 3474.6766 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2854 | GKWERPFEVKDTEEEDFHVDQVTTVKVPMM | Alpha-1 protease inhibitor | Plasma | 3605.7171 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2893 | QLIKAIQLTYNPDESSKPNMIDAATLK | Fibrinogen gamma | Plasma | 3001.5794 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2894 | YRLTYAYFAGGDAGDAFDGFDFGDDPSDK | Fibrinogen gamma | Plasma | 3152.3312 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2895 | TSEVKQLIKAIQLTYNPDESSKPNMIDAATLK | Fibrinogen gamma | Plasma | 3545.8651 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2896 | EGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYAL | Fibrinogen gamma | Plasma | 3713.873 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2897 | IHLISTQSAIPYALRVELEDWNGRTSTADYAMF | Fibrinogen gamma | Plasma | 3767.8618 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2898 | VGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDK | Fibrinogen gamma | Plasma | 3848.6754 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2923 | SILQMSLDHHIVTPLTSLVIENEAGDER | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 3116.5812 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2924 | QTVEAMKTILDDLRAEDHFSVIDFNQNIR | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 3417.6987 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2925 | MKQTVEAMKTILDDLRAEDHFSVIDFNQNI | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 3520.733 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2926 | MKQTVEAMKTILDDLRAEDHFSVIDFNQNIR | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 3676.8342 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2952 | VSEADSSNADWVTKQLNEINYEDHKL | Complement factor B | Plasma | 3004.405 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2991 | TAKDALSSVQESQVAQQARGWVTDGFSSL | Apolipoprotein C-III | Plasma | 3065.5054 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3013 | NMATRPYSIHAHGVQTESSTVTPTLPGETLTYVW | Ceruloplasmin | Plasma | 3743.8254 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3036 | AISGGSIQIENGYFVHYFAPEGLTTMPK | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 3026.4848 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3037 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 3271.6349 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3038 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 3287.6298 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3050 | GMADQDGLKPTIDKPSEDSPPLEMLGPRR | Inter-alpha-trypsin inhibitor heavy chain H1 | Plasma | 3149.5485 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3085 | RVAEGTQVLELPFKGDDITMVLILPKPEK | Antithrombin-III | Plasma | 3235.789 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3104 | LPKFKLEKNYNLVESLKLMGIRMLF | Heparin cofactor 2 | Plasma | 3023.7068 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3127 | TASDFITKMDYPKQTQVSVLPEGGETPLF | Gelsolin | Plasma | 3198.5795 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3128 | AALKTASDFITKMDYPKQTQVSVLPEGGETPLF | Gelsolin | Plasma | 3581.8327 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3156 | SVIRYTCEEPYYYMENGGGGEYHCAGN | Complement C1s subcomponent | Plasma | 3077.2266 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3172 | VLQIEKEGAIHREELVYELNPLDHRG | Complement C4-A | Plasma | 3056.6043 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3187 | DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQI | Clusterin | Plasma | 3806.8381 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3207 | TSESGELHGLTTEEEFVEGIYKVEIDTK | Transthyretin | Plasma | 3139.5085 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3214 | AHYDLRHTFMGVVSLGSPSGEVSHPRKT | Alpha-2-HS-glycoprotein | Plasma | 3064.5301 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3278 | NA | NA | Serum | 3243.9 | MALDI-TOF | Ovarian cancer | Differentially expressed between normal and patients | 22086897 |
| CancerPDF_ID3279 | NA | NA | Serum | 3959 | MALDI-TOF | Ovarian cancer | Differentially expressed between normal and patients | 22086897 |
| CancerPDF_ID3281 | NA | NA | Serum | 3772.6 | MALDI-TOF | Ovarian cancer | Differentially expressed between normal and patients | 22086897 |
| CancerPDF_ID3290 | NA | NA | Serum | 3510.1 | MALDI-TOF | Ovarian cancer | Differentially expressed between normal and patients | 22086897 |
| CancerPDF_ID3303 | NA | NA | Serum | 3194.8 | MALDI-TOF | Ovarian cancer | Differentially expressed between normal and patients | 22086897 |
| CancerPDF_ID3316 | NA | NA | Serum | 3527 | MALDI-TOF | Ovarian cancer | Differentially expressed between normal and patients | 22086897 |
| CancerPDF_ID3318 | NA | NA | Serum | 3161.7 | MALDI-TOF | Ovarian cancer | Differentially expressed between normal and patients | 22086897 |
| CancerPDF_ID3319 | NA | NA | Serum | 3886.1 | MALDI-TOF | Ovarian cancer | Differentially expressed between normal and patients | 22086897 |
| CancerPDF_ID3332 | NA | NA | Serum | 3266.5 | MALDI-TOF | Ovarian cancer | Differentially expressed between normal and patients | 22086897 |
| CancerPDF_ID3335 | NA | NA | Serum | 3616.4 | MALDI-TOF | Ovarian cancer | Differentially expressed between normal and patients | 22086897 |
| CancerPDF_ID3348 | NA | NA | Serum | 3883.45 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3350 | NA | NA | Serum | 3952.19 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3362 | NA | NA | Serum | 3208.49 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3363 | NA | NA | Serum | 3934.92 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3394 | NA | NA | Serum | 3279.09 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID8420 | NA | NA | Serum | 3891.63 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 45.71% ; In Rectal cancer : 33.33% ; Breast cancer: 62%; In normal healthy individuals : 88.2% | 23667664 |
| CancerPDF_ID8425 | NA | NA | Serum | 3152.18 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 52.85% ; In Rectal cancer : 61.11% ; Breast cancer: 43%; In normal healthy individuals : 79.8% | 23667664 |
| CancerPDF_ID8426 | NA | NA | Serum | 3212.45 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 62.86% ; In Rectal cancer : 86.11% ; Breast cancer: 72%; In normal healthy individuals : 79.2% | 23667664 |
| CancerPDF_ID8428 | NA | NA | Serum | 3362.65 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 81.43% ; In Rectal cancer : 91.67% ; Breast cancer: 72%; In normal healthy individuals : 77.4% | 23667664 |
| CancerPDF_ID8431 | NA | NA | Serum | 3434.65 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 84.29% ; In Rectal cancer : 86.11% ; Breast cancer: 77%; In normal healthy individuals :72% | 23667664 |
| CancerPDF_ID8432 | NA | NA | Serum | 3948.85 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 41.43% ; In Rectal cancer : 41.67% ; Breast cancer: 48%; In normal healthy individuals : 71% | 23667664 |
| CancerPDF_ID8438 | NA | NA | Serum | 3302.32 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 92.86% ; In Rectal cancer : 97.22% ; Breast cancer: 95%; In normal healthy individuals : 65% | 23667664 |
| CancerPDF_ID8443 | NA | NA | Serum | 3810.31 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer :35.71% ; In Rectal cancer : 50% ; Breast cancer: 32%; In normal healthy individuals : 57.6% | 23667664 |
| CancerPDF_ID8449 | NA | NA | Serum | 3184.7 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 7.14% ; In Rectal cancer : 50% ; Breast cancer: 30%; In normal healthy individuals : 48.4% | 23667664 |
| CancerPDF_ID8450 | NA | NA | Serum | 3872.19 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 42.86% ; In Rectal cancer : 75% ; Breast cancer: 45%; In normal healthy individuals : 48.2% | 23667664 |
| CancerPDF_ID8454 | NA | NA | Serum | 3254.85 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 24.29% ; In Rectal cancer : 44.44% ; Breast cancer: 21%; In normal healthy individuals : 41.8% | 23667664 |
| CancerPDF_ID8455 | NA | NA | Serum | 3316.32 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 92.86% ; In Rectal cancer : 97.22% ; Breast cancer: 95%; In normal healthy individuals : 40.6% | 23667664 |
| CancerPDF_ID8460 | NA | NA | Serum | 3479.93 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 52.86% ; In Rectal cancer : 58.33% ; Breast cancer: 44%; In normal healthy individuals :34.2% | 23667664 |
| CancerPDF_ID8462 | NA | NA | Serum | 3226.75 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 1.43% ; In Rectal cancer : 2.78% ; Breast cancer: 3%; In normal healthy individuals : 32.6% | 23667664 |
| CancerPDF_ID8467 | NA | NA | Serum | 3241.49 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 88.57% ; In Rectal cancer : 86.11% ; Breast cancer: 83%; In normal healthy individuals : 25.6% | 23667664 |
| CancerPDF_ID8471 | NA | NA | Serum | 3274.73 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 21.43% ; In Rectal cancer : 16.67% ; Breast cancer: 23%; In normal healthy individuals : 25% | 23667664 |
| CancerPDF_ID8472 | NA | NA | Serum | 3962.94 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | Frequency of peptide In lung cancer : 2.86% ; In Rectal cancer : 8.33% ; Breast cancer:3%; In normal healthy individuals : 24% | 23667664 |
| CancerPDF_ID8519 | SSSYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha | Serum | 3189.42 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8524 | GDSTFESKSYKMADEAGSEADHEGTHSTKRGHA | Fibrinogen alpha | Serum | 3522.53 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8525 | SYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha | Serum | 3238.52 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8560 | GLEEELQFSLGSKINVKVGGNSKGTLKVLR | Complement C3f | Serum | 3199.79 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8564 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 3271.63 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8576 | NVHSGSTFFKYYLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 3155.62 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8578 | AELQEGARQKLHELQEKLSPLGEEMRDRA | Aplipoprotein A-I | Serum | 3374.74 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8579 | QGLLPVLESFKVSFLSALEEYTKKLNTQ | Aplipoprotein A-I | Serum | 3181.73 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8587 | DSGPRRYTIAALLSPYSYSTTAVVTNPKE | Transthyretin | Serum | 3156.61 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8601 | SARLNSQRLVFNRPFLMFIVDNNILFLGKVNRP | Protein c inhibitor | Serum | 3888.15 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8614 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter- trypsin inhibitor heavy chain H4 (ITIH4) fragment | Serum | 3273.69 | MALDI-TOF | Breast cancer | Upregulated in cancer as compare to normal control with fold change of 1.7 | 26705257 |
| CancerPDF_ID8619 | FLGDRDFNQFSSGEKNIFLASFVHEYSR | Fetoprotein (AFP) precursor | Serum | 3315.21 | MALDI-TOF | Breast cancer | Downregulated in cancer as compare to normal control with fold change of 1.6 | 26705257 |
| CancerPDF_ID8625 | NA | NA | Serum | 3316 | MS/MS | Esophageal squamous cell carcinoma (ESCC) | Diffrential expressed between cancer and normal | 23586861 |
| CancerPDF_ID8661 | NA | NA | Serum | 3883.64 | MALDI-TOF | "Hepatocellular carcinoma, Liver cirrhosis, Chronic hepatitis" | significantly different from that of normal | 23915185 |
| CancerPDF_ID9922 | GPPPQGGNKPQGPPPPGKPQGPPPQGDKS | Basic salivary proline-rich protein 2 | Saliva | 3135.59 | MALDI-TOF | Head and neck cancer | Differentially expressed between Head and neck cancer vs control groups | 20879038 |
| CancerPDF_ID10674 | DGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPG | CD99 antigen | Urine | 3022.3573 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10675 | LKNGERIEKVEHSDLSFSKDWSFYL | Beta-2-microglobulin | Urine | 3027.5298 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10676 | KVEIDTKSYWKALGISPFHEHAEVVF | Transthyretin | Urine | 3030.571 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10677 | LNNFYPREAKVQWKVDNALQSGNSQE | Ig kappa chain C region | Urine | 3035.4949 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10678 | GHRPLDKKREEAPSLRPAPPPISGGGYR | Fibrinogen beta chain | Urine | 3038.6362 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10679 | FVKHQTVPQNTGGKNPDPWAKNLNEKD | Serotransferrin precursor | Urine | 3062.5133 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10680 | VDLLKNGERIEKVEHSDLSFSKDWSF | Beta-2-microglobulin | Urine | 3078.5558 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10681 | KAVADTRDQADGSRASVDSGSSEEQGGSSRA | Polymeric immunoglobulin receptor | Urine | 3081.3834 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10682 | VTLAAHLPAEFTPAVHASLDKFLASVSTVL | Hemoglobin subunit alpha | Urine | 3105.6885 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10683 | VKDYFPEPVTVSWNSGALTSGVHTFPAVL | Ig gamma-1 chain C region | Urine | 3118.5887 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10684 | FSQFPHGQKGQHYSGQKGKQQTESKGSF | Semenogelin-1 | Urine | 3138.4767 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10685 | GTFATLSELHCDKLHVDPENFRLLGNVL | Hemoglobin subunit beta | Urine | 3138.5392 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10686 | IVITEHEVAQDDHLTQQYNEDRNPIST | Semenogelin-2 | Urine | 3165.4837 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10687 | IEVDLLKNGERIEKVEHSDLSFSKDWS | Beta-2-microglobulin | Urine | 3173.6186 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10688 | AKVQWKVDNALQSGNSQESVTEQDSKDST | Ig kappa chain C region | Urine | 3179.5088 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10689 | VAHVDDMPNALSALSDLHAHKLRVDPVNF | Hemoglobin subunit alpha | Urine | 3181.6283 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10690 | VLSPADKTNVKAAWGKVGAHAGEYGAEALER | Hemoglobin subunit alpha | Urine | 3195.6587 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10691 | VSETESRGSESGIFTNTKESSSHHPGIAEF | Fibrinogen alpha chain | Urine | 3207.4794 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10692 | VAWKADSSPVKAGVETTTPSKQSNNKYAASS | Ig lambda chain C regions | Urine | 3209.6254 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10693 | LTKKFSRHHGPTITAKLYGRAPQLRETL | Protein AMBP | Urine | 3219.8119 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10694 | EEVSGNVSPGTRREYHTEKLVTSKGDKEL | Fibrinogen alpha chain | Urine | 3245.6466 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10695 | LGRHSLFHPEDTGQVFQVSHSFPHPLYD | Prostate-specific antigen | Urine | 3247.5536 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10696 | AWKADSSPVKAGVETTTPSKQSNNKYAASSY | Ig lambda chain C regions | Urine | 3273.6064 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10697 | VHLTPEEKSAVTALWGKVNVDEVGGEALGRL | Hemoglobin subunit beta | Urine | 3274.7428 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10698 | DGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVG | CD99 antigen | Urine | 3291.569 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10699 | AEYHAKATEHLSTLSEKAKPALEDLRQGLL | Apolipoprotein A-I | Urine | 3319.7917 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10700 | IEVDLLKNGERIEKVEHSDLSFSKDWSF | Beta-2-microglobulin | Urine | 3320.6998 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10701 | VLSPADKTNVKAAWGKVGAHAGEYGAEALERM | Hemoglobin subunit alpha | Urine | 3326.7238 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10702 | PYQYPALTPEQKKELSDIAHRIVAPGKGIL | Fructose-bisphosphate aldolase A | Urine | 3332.8627 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10703 | EEKAVADTRDQADGSRASVDSGSSEEQGGSSRA | Polymeric immunoglobulin receptor | Urine | 3339.4925 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10704 | VDLLKNGERIEKVEHSDLSFSKDWSFYL | Beta-2-microglobulin | Urine | 3354.7279 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10705 | EDPQGDAAQKTDTSHHDQDHPTFNKITPNL | Alpha-1-antitrypsin | Urine | 3357.5577 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10706 | ADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVG | CD99 antigen | Urine | 3362.5659 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10707 | VAWKADSSPVKAGVETTTPSKQSNNKYAASSY | Ig lambda chain C regions | Urine | 3372.6855 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10708 | VAHVDDMPNALSALSDLHAHKLRVDPVNFKL | Hemoglobin subunit alpha | Urine | 3422.8282 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10709 | EEKAVADTRDQADGSRASVDSGSSEEQGGSSRAL | Polymeric immunoglobulin receptor | Urine | 3452.5888 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10710 | VLSPADKTNVKAAWGKVGAHAGEYGAEALERMF | Hemoglobin subunit alpha | Urine | 3473.7931 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10711 | IEVDLLKNGERIEKVEHSDLSFSKDWSFY | Beta-2-microglobulin | Urine | 3483.7427 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10712 | VAWKADSSPVKAGVETTTPSKQSNNKYAASSYL | Ig lambda chain C regions | Urine | 3485.7858 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10713 | AHHFGKEFTPPVQAAYQKVVAGVANALAHKYH | Hemoglobin subunit beta | Urine | 3486.8198 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10714 | PTTKTYFPHFDLSHGSAQVKGHGKKVADALTNA | Hemoglobin subunit alpha | Urine | 3523.8388 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10715 | VAVHVFRKAADDTWEPFASGKTSESGELHGLTT | Transthyretin | Urine | 3543.7714 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10716 | EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAE | Alpha-1-antitrypsin | Urine | 3557.6388 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10717 | GQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVL | Alpha-1-antitrypsin | Urine | 3578.0334 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10718 | AEYHAKATEHLSTLSEKAKPALEDLRQGLLPVL | Apolipoprotein A-I | Urine | 3629.0153 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10719 | VLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH | Hemoglobin subunit beta | Urine | 3698.9762 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10720 | EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEF | Alpha-1-antitrypsin | Urine | 3704.7076 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10721 | FVEGIYKVEIDTKSYWKALGISPFHEHAEVVF | Transthyretin | Urine | 3738.9299 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10722 | EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFA | Alpha-1-antitrypsin | Urine | 3775.7665 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10723 | STPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTF | Hemoglobin subunit beta | Urine | 3821.0473 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10724 | AVHVFRKAADDTWEPFASGKTSESGELHGLTTEEE | Transthyretin | Urine | 3831.8486 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10725 | AEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLES | Apolipoprotein A-I | Urine | 3845.1017 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10726 | LSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNA | Hemoglobin subunit alpha | Urine | 3871.0499 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10727 | VCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH | Hemoglobin subunit beta | Urine | 3901.0777 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10728 | VAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEE | Transthyretin | Urine | 3930.8524 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10997 | GESGREGAPGAEGSPGRDGSPGAKGDRGETGP | Collagen alpha-1(I) chain | Urine | 3000.2871 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10998 | ESGREGAPGAEGSPGRDGSPGAKGDRGETGPA | Collagen alpha-1(I) chain | Urine | 3014.3608 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10999 | ARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKG | Collagen alpha-1(III) chain | Urine | 3024.3801 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11000 | QNGEPGGKGERGAPGEKGEGGPPGVAGPPGGSGP | Collagen alpha-1(III) chain | Urine | 3059.3961 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11001 | EAGRDGNPGNDGPPGRDGQPGHKGERGYPG | Collagen alpha-2(I) chain | Urine | 3065.3383 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11002 | QNGEPGGKGERGAPGEKGEGGPPGVAGPPGGSGP | Collagen alpha-1(III) chain | Urine | 3075.3859 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11003 | VAHVDDMPNALSALSDLHAHKLRVDPVNF | Hemoglobin subunit alpha | Urine | 3197.6092 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11004 | PPGESGREGAPGAEGSPGRDGSPGAKGDRGETGP | Collagen alpha-1(I) chain | Urine | 3210.4694 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11005 | PPGESGREGAPGAEGSPGRDGSPGAKGDRGETGP | Collagen alpha-1(I) chain | Urine | 3226.3807 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11006 | ENGKPGEPGPKGDAGAPGAPGGKGDAGAPGERGPPG | Collagen alpha-1(III) chain | Urine | 3243.4948 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11007 | RTGEVGAVGPPGFAGEKGPSGEAGTAGPPGTPGPQG | Collagen alpha-2(I) chain | Urine | 3249.5368 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11008 | ENGKPGEPGPKGDAGAPGAPGGKGDAGAPGERGPPG | Collagen alpha-1(III) chain | Urine | 3259.5101 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11009 | RTGEVGAVGPPGFAGEKGPSGEAGTAGPPGTPGPQG | Collagen alpha-2(I) chain | Urine | 3265.5277 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11010 | AAGEPGKAGERGVPGPPGAVGPAGKDGEAGAQGPPGP | Collagen alpha-1(I) chain | Urine | 3265.5702 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11011 | GPPGESGREGAPGAEGSPGRDGSPGAKGDRGETGP | Collagen alpha-1(I) chain | Urine | 3267.4917 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11012 | NTGAPGSPGVSGPKGDAGQPGEKGSPGAQGPPGAPGP | Collagen alpha-1(III) chain | Urine | 3272.4927 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11013 | ENGKPGEPGPKGDAGAPGAPGGKGDAGAPGERGPPG | Collagen alpha-1(III) chain | Urine | 3275.4979 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11014 | PPGESGREGAPGAEGSPGRDGSPGAKGDRGETGPA | Collagen alpha-1(I) chain | Urine | 3281.4884 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11015 | NTGAPGSPGVSGPKGDAGQPGEKGSPGAQGPPGAPGP | Collagen alpha-1(III) chain | Urine | 3288.4952 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11016 | NTGAPGSPGVSGPKGDAGQPGEKGSPGAQGPPGAPGP | Collagen alpha-1(III) chain | Urine | 3304.4968 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11017 | ERGEAGIPGVPGAKGEDGKDGSPGEPGANGLPGAAG | Collagen alpha-1(III) chain | Urine | 3308.504 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11018 | GPPGESGREGAPGAEGSPGRDGSPGAKGDRGETGPA | Collagen alpha-1(I) chain | Urine | 3338.5287 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11019 | GAPGQNGEPGGKGERGAPGEKGEGGPPGVAGPPGGSGP | Collagen alpha-1(III) chain | Urine | 3373.5214 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11020 | PPGADGQPGAKGEPGDAGAKGDAGPPGPAGPAGPPGPIG | Collagen alpha-1(I) chain | Urine | 3376.5722 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11021 | VKGERGSPGGPGAAGFPGARGLPGPPGSNGNPGPPGP | Collagen alpha-1(III) chain | Urine | 3386.609 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11022 | ARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGP | Collagen alpha-1(III) chain | Urine | 3406.5192 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11023 | VAHVDDMPNALSALSDLHAHKLRVDPVNFKL | Hemoglobin subunit alpha | Urine | 3438.8067 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11024 | NTGAPGSPGVSGPKGDAGQPGEKGSPGAQGPPGAPGPLG | Collagen alpha-1(III) chain | Urine | 3458.629 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11025 | NTGAPGSPGVSGPKGDAGQPGEKGSPGAQGPPGAPGPLG | Collagen alpha-1(III) chain | Urine | 3474.6119 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11026 | QNGEPGGKGERGAPGEKGEGGPPGVAGPPGGSGPAGPPGPQG | Collagen alpha-1(III) chain | Urine | 3736.6961 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11037 | NA | NA | Serum | 3317 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11055 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | ITIH4 | Serum | 3273 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Downregulated in ESCC patients vs control with mean intensity in cancer 221.86 and mean intensity in normal 764.46 | 26993605 |
| CancerPDF_ID11056 | SYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Serum | 3239.9 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Upregulated in ESCC patients vs control with mean intensity in cancer as 831.12 and mean intensity in control as 100.55 | 26993605 |
| CancerPDF_ID11067 | NA | NA | Serum | 3883.6 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Upregulated in ESCC patients vs control | 26993605 |
| CancerPDF_ID11068 | NA | NA | Serum | 3249.2 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Upregulated in ESCC patients vs control | 26993605 |
| CancerPDF_ID11070 | NA | NA | Serum | 3264.9 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Downregulated in ESCC patients vs control with mean intensity in cancer and mean intensity in normal | 26993605 |
| CancerPDF_ID11088 | NA | ADA19_HUMAN | Urine | 3151.096 | MALDI-TOF | Clear cell renal carcinoma | "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" | 26482227 |
| CancerPDF_ID11089 | NA | RSPH3_HUMAN | Urine | 3151.096 | MALDI-TOF | Clear cell renal carcinoma | "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" | 26482227 |
| CancerPDF_ID11090 | NA | DREB_HUMAN | Urine | 3571.126 | MALDI-TOF | Clear cell renal carcinoma | "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" | 26482227 |
| CancerPDF_ID11091 | NA | G3P_HUMAN | Urine | 3723.84 | MALDI-TOF | Clear cell renal carcinoma | Downregulated with increse in tumor mass | 26482227 |
| CancerPDF_ID11113 | NA | NA | Urine | 3723.8 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in grade vs normal | 26482227 |
| CancerPDF_ID11114 | NA | NA | Urine | 3571.1 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in grade vs normal | 26482227 |
| CancerPDF_ID12727 | KMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Serum | 3005.608 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.73 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 2.39, Upregulated in BC vs healthy with 2.324 fold change" | 27058005 |
| CancerPDF_ID12728 | SSSYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha chain | Serum | 3206.443 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.44 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.05, Upregulated in BC vs healthy with 0.958 fold change" | 27058005 |
| CancerPDF_ID12729 | SSSYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha chain | Serum | 3277.592 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.43 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.11, Upregulated in BC vs healthy with 0.942 fold change" | 27058005 |
| CancerPDF_ID12738 | NVHSGSTFFKYYLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 3156.679 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.52 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.11, Upregulated in BC vs healthy with 1.158 fold change" | 27058005 |
| CancerPDF_ID12739 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 3272.752 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.42 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.89, Upregulated in BC vs healthy with 1.036 fold change" | 27058005 |
| CancerPDF_ID12740 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 3288.759 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.34 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.85, Upregulated in BC vs healthy with 1.126 fold change" | 27058005 |
| CancerPDF_ID12741 | QAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 3969.989 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.57 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.82, Upregulated in BC vs healthy with 1.170 fold change" | 27058005 |
| CancerPDF_ID12760 | NA | NA | Serum | 3194.1 | MALDI-TOF | Cervical cancer | Downregulated in Cervical squamous cell carcinoma vs healthy | 26282206 |
| CancerPDF_ID12761 | SSSYSKQFTSSTSYNRGDSTFESKSYKM | "FGA, Isoform 2 of Fibrinogen alpha chain" | Serum | 3210 | MALDI-TOF | Cervical cancer | Downregulated in Cervical squamous cell carcinoma vs healthy | 26282206 |
| CancerPDF_ID12762 | SSSYSKQFTSSTSYNRGDSTFESKSYKMA | "FGA, Isoform 2 of Fibrinogen alpha chain" | Serum | 3265.1 | MALDI-TOF | Cervical cancer | Downregulated in Cervical squamous cell carcinoma vs healthy | 26282206 |
| CancerPDF_ID12763 | DAHKSEVAHRFKDLGEENFKALVLIAFAQ | "Albumin, Isoform CRA_f" | Serum | 3281.7 | MALDI-TOF | Cervical cancer | Downregulated in Cervical squamous cell carcinoma vs healthy | 26282206 |
| CancerPDF_ID12764 | NA | NA | Serum | 3885.5 | MALDI-TOF | Cervical cancer | Upregulated in Cervical squamous cell carcinoma vs healthy | 26282206 |
| CancerPDF_ID12803 | NA | NA | Serum | 3242.81 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12811 | NA | NA | Serum | 3263.33 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12812 | NA | NA | Serum | 3265.04 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12817 | NA | NA | Serum | 3952.11 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12818 | NA | NA | Serum | 3955.46 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12821 | NA | NA | Serum | 3885.75 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12824 | NA | NA | Serum | 3193.79 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12837 | NA | NA | Serum | 3938.59 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID14195 | NA | NA | Serum | 3000.11 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14196 | NA | NA | Serum | 3102.33 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14197 | NA | NA | Serum | 3169.15 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14198 | NA | NA | Serum | 3177.41 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14199 | NA | NA | Serum | 3192.36 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14200 | NA | NA | Serum | 3202.88 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14201 | NA | NA | Serum | 3219.25 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14202 | NA | NA | Serum | 3225.57 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14203 | NA | NA | Serum | 3241.58 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14204 | NA | NA | Serum | 3243.83 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14205 | NA | NA | Serum | 3251.37 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14206 | NA | NA | Serum | 3259.8 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14207 | NA | NA | Serum | 3263.78 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14208 | NA | NA | Serum | 3273.51 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14209 | NA | NA | Serum | 3285.31 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14210 | NA | NA | Serum | 3295.4 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14211 | NA | NA | Serum | 3304.01 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14212 | NA | NA | Serum | 3310.7 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14213 | NA | NA | Serum | 3311.31 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14214 | NA | NA | Serum | 3320.99 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14215 | NA | NA | Serum | 3339.94 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14216 | NA | NA | Serum | 3390.86 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14217 | NA | NA | Serum | 3409.35 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14218 | NA | NA | Serum | 3458.93 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14219 | NA | NA | Serum | 3478.14 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14220 | NA | NA | Serum | 3516.41 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14221 | NA | NA | Serum | 3534.25 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14222 | NA | NA | Serum | 3551.67 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14223 | NA | NA | Serum | 3706.99 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14224 | NA | NA | Serum | 3797.42 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14225 | NA | NA | Serum | 3822.52 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14226 | NA | NA | Serum | 3838.14 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14227 | NA | NA | Serum | 3941.59 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14228 | NA | NA | Serum | 3961.49 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14229 | NA | NA | Serum | 3968.83 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14230 | NA | NA | Serum | 3976.47 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14231 | NA | NA | Serum | 3984.71 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14232 | NA | NA | Serum | 3986.36 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14233 | NA | NA | Serum | 3992.66 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14299 | NA | NA | Serum | 3316.09 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14301 | NA | NA | Serum | 3217.15 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14302 | NA | NA | Serum | 3951.98 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14309 | NA | NA | Serum | 3934.72 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14312 | NA | NA | Serum | 3308.63 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14320 | NA | NA | Serum | 3506.97 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14323 | NA | NA | Serum | 3192.1 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14326 | NA | NA | Serum | 3918.04 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14362 | NA | NA | Serum | 3883.64 | MB-WCX | Hepatocellular carcinoma | NA | 23915185 |