Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID2014 | KFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQ | Zyxin | Serum | 4064.96167 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID3402 | QTPKHISESLGAEVDPDMSWSSSLATPPTLSSTVLIGLLHSSVK | Breast cancer type 2 susceptibility protein | Plasma | NA | Linear ion-trap mass spectrometer (LTQ) coupled with a Surveyor HPLC-MS | Breast cancer | Differentially expressed between normal and patients | 24565027 |
| CancerPDF_ID3407 | QVLPVGVLGPPGQQAPPPYPGPHPAGPPVIQQPTTPMFVAPPPK | Protein polybromo-1 | Plasma | NA | Linear ion-trap mass spectrometer (LTQ) coupled with a Surveyor HPLC-MS | Breast cancer | Differentially expressed between normal and patients | 24565027 |
| CancerPDF_ID3517 | SNGNpGPPGPSGSPGKDGPPGpAGNTGApGSpGVSGPKGDAGQPG | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3809 | GPPGPAGFAGPPGADGQpGAKGEpGDAGAKGDAGPpGPAGPAG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3810 | FAGpPGADGQPGAKGEpGDAGAKGDAGPpGPAGPAGPpGPIG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3817 | GppGPRGPQGPNGADGPqGPPGSVGSVGGVGEKGEPGEAGnPG | Collagen alpha-1(XI) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3820 | SNGNpGPPGPSGSPGKDGPPGpAGNTGApGSpGVSGPKGDAGQPG | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3834 | EKDHLVNDYEQNmKLLQTKYDADINLLKQEHALSASKASSMIE | Centrosomal protein of 112 kDa | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID4670 | DQGPVGRTGEVGAVGPPGFAGEKGPSGEAGTAGPPGTPGPQG | Collagen alpha-2(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5322 | GVGAGGFPGFGVGVGGIPGVAGVPGVGGVPGVGGVPGVGISPEA | Elastin isoform c precursor | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5323 | GVGAGGFPGFGVGVGGIPGVAGVPSVGGVPGVGGVPGVGISPEA | Isoform 10 of Elastin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5807 | LGAGIPGLGVGVGVPGLGVGAGVPGLGVGAGVPGFGAVPGA | Elastin isoform c precursor | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6137 | LVPGVGVAPGVGVAPGVGVAPGVGLAPGVGVAPGVGVAPGVG | Elastin isoform c precursor | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7848 | VGSPGLPGAIGTDGTPGAKGPTGSPGTSGPPGSAGPPGSPGP | Collagen alpha-2(V) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8520 | SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHGTHSTK | Fibrinogen alpha | Serum | 4783.09 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8596 | LEAIPMSIPPEVKFNKPFVFLMIDQNTKSPLFMGKVVNPTQK | Alpha-1 antitrypsin | Serum | 4772.55 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8617 | NVHSAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter- trypsin inhibitor heavy chain H4 (ITIH4) fragment | Serum | 4280.55 | MALDI-TOF | Breast cancer | Upregulated in cancer as compare to normal control with fold change of 1.10 | 26705257 |
| CancerPDF_ID10732 | FESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTF | Hemoglobin subunit beta | Urine | 4616.5053 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11026 | QNGEPGGKGERGAPGEKGEGGPPGVAGPPGGSGPAGPPGPQG | Collagen alpha-1(III) chain | Urine | 3736.6961 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11027 | NDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGSNGAPG | Collagen alpha-1(III) chain | Urine | 4022.7806 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11028 | SKGESGNKGEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPPGPPG | Collagen alpha-2(I) chain | Urine | 4066.8417 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11029 | SKGESGNKGEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPPGPPG | Collagen alpha-2(I) chain | Urine | 4114.8649 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |