Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID11 | GSESGIFTNTKESSSHHPGIAEFPSRG | Fibrinogen alpha chain | Serum | 2816.25 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID14 | SSSYSKQFTSSTSYNRGDSTFESKSY | Fibrinogen alpha chain | Serum | 2931.29 | MALDI-TOF | Metastatic thyroid carcinomas | Differentially expressed between cancer vs normal samples | 16896061 |
| CancerPDF_ID15 | SSSYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha chain | Serum | 3190.4 | MALDI-TOF | Metastatic thyroid carcinomas | Differentially expressed between cancer vs normal samples | 16896061 |
| CancerPDF_ID16 | SSSYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha chain | Serum | 3261.4 | MALDI-TOF | Metastatic thyroid carcinomas | Differentially expressed between cancer vs normal samples | 16896061 |
| CancerPDF_ID22 | SYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Serum | 3239.22 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID41 | GLEEELQFSLGSKINVKVGGNSKGTL | Complement C4 precursor | Serum | 2704.13 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID42 | GLEEELQFSLGSKINVKVGGNSKGTLKVLR | Complement C4 precursor | Serum | 3200.52 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID54 | PGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H12 | Serum | 2724.48 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID55 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H13 | Serum | 3272.5 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID59 | NVHSGSTFFKYYLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H17 | Serum | 3156.52 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID71 | QGLLPVLESFKVSFLSALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 3182.46 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID77 | AELQEGARQKLHELQEKLSPLGEEMRDRA | Apolipoprotein A-I | Serum | 3377.45 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID204 | NVHSGSTFFKYYLQGAKIPKPEASFSPR | inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 3156.6207 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS | 19728888 |
| CancerPDF_ID249 | NVHSGSTFFKYYLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 3156.6207 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID364 | SLPELEQQQEQQQEQQQEQVQMLAPLES | Apolipoprotein A-IV | Plasma | 1108.19 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID400 | GSTGNRNPGSSGTGGTATWKPGSSGP | Fibrinogen alpha chain | Plasma | "1188.05, 792.37" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID497 | GSTGSWNSGSSGTGSTGNQNPGSPRPGSTG | Fibrinogen alpha chain | Plasma | 912.73 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID498 | GSTGSWNSGSSGTGSTGNQNPGSPRPGST | Fibrinogen alpha chain | Plasma | 893.72 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID499 | GSTGSWNSGSSGTGSTGNQNPGSPRPG | Fibrinogen alpha chain | Plasma | 831.03 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID500 | STGSWNSGSSGTGSTGNQNPGSPRPGSTGT | Fibrinogen alpha chain | Plasma | 927.4 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID501 | STGSWNSGSSGTGSTGNQNPGSPRPG | Fibrinogen alpha chain | Plasma | 812.02 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID502 | TGSWNSGSSGTGSTGNQNPGSPRPGSTGT | Fibrinogen alpha chain | Plasma | 898.39 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID504 | SWNSGSSGTGSTGNQNPGSPRPGSTGTWN | Fibrinogen alpha chain | Plasma | 945.74 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID505 | SWNSGSSGTGSTGNQNPGSPRPGSTGT | Fibrinogen alpha chain | Plasma | 845.7 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID507 | WNSGSSGTGSTGNQNPGSPRPGSTGT | Fibrinogen alpha chain | Plasma | 816.69 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID509 | NSGSSGTGSTGNQNPGSPRPGSTGTWN | Fibrinogen alpha chain | Plasma | 854.71 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID512 | SSGTGSTGNQNPGSPRPGSTGTWNPGSSER | Fibrinogen alpha chain | Plasma | 973.1 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID513 | SSGTGSTGNQNPGSPRPGSTGTWNPGSSE | Fibrinogen alpha chain | Plasma | 921.07 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID514 | SGTGSTGNQNPGSPRPGSTGTWNPGSSE | Fibrinogen alpha chain | Plasma | 892.06 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID552 | GDSTFESKSYKMADEAGSEADHEGTHSTKR | Fibrinogen alpha chain | Plasma | 1086.81 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID557 | SYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Plasma | 1080.51 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID558 | SYKMADEAGSEADHEGTHSTKRGHAK | Fibrinogen alpha chain | Plasma | 934.09 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID570 | GSESGIFTNTKESSSHHPGIAEFPSRGK | Fibrinogen alpha chain | Plasma | "982.14, 736.85" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID571 | GSESGIFTNTKESSSHHPGIAEFPSRG | Fibrinogen alpha chain | Plasma | "939.44, 704.83" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID572 | GSESGIFTNTKESSSHHPGIAEFPSR | Fibrinogen alpha chain | Plasma | "920.43, 690.58" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID592 | SESSVSGSTGQWHSESGSFRPDSPGSGN | Fibrinogen alpha chain | Plasma | 937.4 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID596 | SESGSFRPDSPGSGNARPNNPDWGTFEEVSGN | Fibrinogen alpha chain | Plasma | 1117.82 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID597 | SESGSFRPDSPGSGNARPNNPDWGTFEEV | Fibrinogen alpha chain | Plasma | 1031.79 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID606 | ESGSFRPDSPGSGNARPNNPDWGTFEEV | Fibrinogen alpha chain | Plasma | 1002.78 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID694 | GGSTSYGTGSETESPRNPSSAGSWNSGS | Fibrinogen alpha chain | Plasma | 902.04 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID695 | GGSTSYGTGSETESPRNPSSAGSWNSG | Fibrinogen alpha chain | Plasma | 873.03 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID699 | STSYGTGSETESPRNPSSAGSWNSGSSGP | Fibrinogen alpha chain | Plasma | 944.39 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID700 | YGTGSETESPRNPSSAGSWNSGSSGP | Fibrinogen alpha chain | Plasma | 852.69 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID725 | VHLTPEEKSAVTALWGKVNVDEVGGEALGR | Hemoglobin subunit beta | Plasma | 1054.55 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID727 | LTPEEKSAVTALWGKVNVDEVGGEALGR | Hemoglobin subunit beta | Plasma | 975.84 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID832 | EEAGARVQQNVPSGTDTGDPQSKPLG | Apolipoprotein L1 | Plasma | 880.09 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID838 | ALTSEEAERSDGDPVQPAVLQVHQTS | Serum deprivation-response protein | Plasma | 922.11 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID1028 | GSESGIFTNTKESSSHHPGIAEFPSRG | Fibrinogen alpha chain | Serum | 2816.25 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 68, 223 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1031 | SSSYSKQFTSSTSYNRGDSTFESKSY | Fibrinogen alpha chain | Serum | 2931.29 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in bladder cancer and upregulated in prostate cancer vs normal with Ratio of median intensity (patients/Controls) = 1.24, 0.13 and 0.97 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1032 | SSSYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha chain | Serum | 3190.4 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.52, 0 and 0.94 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1033 | SSSYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha chain | Serum | 3261.4 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.33, 0.08 and 0.74 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1038 | SYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Serum | 3239.22 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1056 | GLEEELQFSLGSKINVKVGGNSKGTL | Complement C4 precursor | Serum | 2704.13 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =61, 49 and 133 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1057 | GLEEELQFSLGSKINVKVGGNSKGTLKVLR | Complement C4 precursor | Serum | 3200.52 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1065 | PGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H10 | Serum | 2724.48 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.75, 6.17 and 1.64 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1066 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H11 | Serum | 3272.5 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1, 1277 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1070 | NVHSGSTFFKYYLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H15 | Serum | 3156.52 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =3.43, 10.68 and 1.33 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1073 | QGLLPVLESFKVSFLSALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 3182.46 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =0.74, 6.36 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1076 | AELQEGARQKLHELQEKLSPLGEEMRDRA | Apolipoprotein A-I | Serum | 3377.45 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1263 | SSSYSKQFTSSTSYNRGDSTFESKSY | Fibrinogen alpha | Serum | 2930.28424 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1264 | YSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha | Serum | 2999.36072 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1265 | SSSYSKQFTSSTSYNRGDSTFESKSYK | Fibrinogen alpha | Serum | 3058.3792 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1266 | SYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha | Serum | 3086.39274 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1267 | GKSSSYSKQFTSSTSYNRGDSTFESKSY | Fibrinogen alpha | Serum | 3115.40067 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1268 | SSSYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha | Serum | 3189.41969 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1284 | SSSYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha | Serum | 3205.4146 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1285 | SSSYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha | Serum | 3260.4568 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1286 | SSSYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha | Serum | 3260.4568 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1287 | GKSSSYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha | Serum | 3374.53611 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1299 | GKSSSYSKQFTSSTSYNRGDSTFESK | Fibrinogen alpha | Serum | 2865.30531 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1300 | GDSTFESKSYKMADEAGSEADHEGTHST | Fibrinogen alpha | Serum | 2973.22065 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1301 | SYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha | Serum | 3015.35563 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1302 | SSYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha | Serum | 3102.38766 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1307 | SSYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha | Serum | 3173.42477 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1308 | SSSYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha | Serum | 3276.45172 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1325 | GKSSSYSKQFTSSTSYNRGDSTFESKS | Fibrinogen alpha | Serum | 2952.33734 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1348 | SYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha | Serum | 3238.51738 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1349 | GKSSSYSKQFTSSTSYNRGDSTFESKSYK | Fibrinogen alpha | Serum | 3243.49563 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1389 | GNTEGLQKSLAELGGHLDQQVEEFRR | Apolipoprotein A-IV | Serum | 2910.4584 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1395 | TLSLPELEQQQEQQQEQQQEQVQMLAPLES | Apolipoprotein A-IV | Serum | 3536.69407 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1603 | LAEYHAKATEHLSTLSEKAKPALEDLR | Apolipoprotein A-I | Serum | 3020.5931 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1620 | SVLGQLGITKVFSNGADLSGVTEEAPLKLS | Alpha-1 protease inhibitor | Serum | 3029.62848 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1648 | SVLGQLGITKVFSNGADLSGVTEEAPLK | Alpha-1 protease inhibitor | Serum | 2829.51239 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1676 | AHYDLRHTFMGVVSLGSPSGEVSHPR | Alpha-2-HS-glycoprotein | Serum | 2835.38748 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1681 | AHYDLRHTFMGVVSLGSPSGEVSHPRKT | Alpha-2-HS-glycoprotein | Serum | 3064.53012 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1801 | ALTSEEAERSDGDPVQPAVLQVHQTS | Serum deprivation-response protein | Serum | 2763.33113 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1802 | SYALTSEEAERSDGDPVQPAVLQVHQTS | Serum deprivation-response protein | Serum | 3013.42649 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1812 | SDMRQEKPSSPSPMPSSTPSPSLNLG | Serum deprivation-response protein | Serum | 2713.26873 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1821 | GMADQDGLKPTIDKPSEDSPPLEMLGPR | Inter-alpha-trypsin inhibitor heavy chain H1 | Serum | 2993.44742 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1908 | VTASDPLDTLGSEGALSPGGVASLLR | Complement C4-B | Serum | 2482.2915 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1922 | KKEVYMPSSIFQDDFVIPDISEPGTWK | Complement C4-B | Serum | 3155.55254 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1974 | GFPRGDKLFGPDLKLVPPMEEDYPQFGSPK | Alpha-2-antiplasmin | Serum | 3360.68528 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1989 | VTEPISAESGEQVERVNEPSILEMSR | Apolipoprotein-L1 | Serum | 2885.40767 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1991 | VTEPISAESGEQVERVNEPSILEMSR | Apolipoprotein-L1 | Serum | 2901.40258 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2001 | NTQPRGPPASSPAPAPKFSPVTPKFTPVAS | Zyxin | Serum | 3030.5927 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2044 | GSKGPLDQLEKGGETAQSADPQWEQLNN | Heparin cofactor 2 | Serum | 2996.41117 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2047 | TAFGGRRAVPPNNSNAAEDDLPTVELQGVVPR | Coagulation factor XIII A chain | Serum | 3346.70181 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID2065 | KSNEQATSLNTVGGTGGIGGVGGTGGVGNR | Multimerin-1 | Serum | 2701.33795 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2154 | NRIPESGGDNSVFDIFELTGAARKGSGR | Thrombospondin-1 | Serum | 2949.4693 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2211 | SSVDELVGIDYSLMKDPVASTSNLDMDFR | Phospholipid transfer protein | Serum | 3203.50025 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2407 | MADEAGSEADHEGTHSTKRGHAKSRP | Fibrinogen alpha | Plasma | 2761.2587 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2409 | SYKMADEAGSEADHEGTHSTKRGHAK | Fibrinogen alpha | Plasma | 2799.2631 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2410 | GSESGIFTNTKESSSHHPGIAEFPSRG | Fibrinogen alpha | Plasma | 2815.3162 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2412 | MADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha | Plasma | 2860.3271 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2413 | GKSSSYSKQFTSSTSYNRGDSTFESK | Fibrinogen alpha | Plasma | 2865.3053 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2414 | SSSYSKQFTSSTSYNRGDSTFESKSY | Fibrinogen alpha | Plasma | 2930.2842 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2415 | GSESGIFTNTKESSSHHPGIAEFPSRGK | Fibrinogen alpha | Plasma | 2943.4111 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2416 | MELERPGGNEITRGGSTSYGTGSETESPR | Fibrinogen alpha | Plasma | 3054.3949 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2417 | SSSYSKQFTSSTSYNRGDSTFESKSYK | Fibrinogen alpha | Plasma | 3058.3792 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2418 | RGFGSLNDEGEGEFWLGNDYLHLLTQR | Fibrinogen alpha | Plasma | 3122.4846 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2419 | VPPEWKALTDMPQMRMELERPGGNEIT | Fibrinogen alpha | Plasma | 3124.5144 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2420 | DSHSLTTNIMEILRGDFSSANNRDNTYN | Fibrinogen alpha | Plasma | 3184.448 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2421 | SYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha | Plasma | 3238.5174 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2422 | AFFDTASTGKTFPGFFSPMLGEFVSETESR | Fibrinogen alpha | Plasma | 3305.5227 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2423 | HRHPDEAAFFDTASTGKTFPGFFSPMLGEF | Fibrinogen alpha | Plasma | 3343.5397 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2424 | SQLQKVPPEWKALTDMPQMRMELERPGGN | Fibrinogen alpha | Plasma | 3365.6683 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2539 | LAEYHAKATEHLSTLSEKAKPALEDL | Apolipoprotein A-I | Plasma | 2864.492 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2542 | THLAPYSDELRQRLAARLEALKENGGA | Apolipoprotein A-I | Plasma | 2978.5686 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2543 | VKDLATVYVDVLKDSGRDYVSQFEGSALG | Apolipoprotein A-I | Plasma | 3130.5823 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2544 | AELQEGARQKLHELQEKLSPLGEEMRDR | Apolipoprotein A-I | Plasma | 3289.6837 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2545 | ATEHLSTLSEKAKPALEDLRQGLLPVLESF | Apolipoprotein A-I | Plasma | 3291.7715 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2546 | LREQLGPVTQEFWDNLEKETEGLRQEMS | Apolipoprotein A-I | Plasma | 3361.6249 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2636 | GNTEGLQKSLAELGGHLDQQVEEFRR | Apolipoprotein A-IV | Plasma | 2910.4584 | LC-MS | Normal | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID2637 | RGNTEGLQKSLAELGGHLDQQVEEFR | Apolipoprotein A-IV | Plasma | 2910.4584 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2639 | IGDNLRELQQRLEPYADQLRTQVNTQAEQL | Apolipoprotein A-IV | Plasma | 3538.8128 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2642 | SLAPYAQDTQEKLNHQLEGLTFQMKKNAEELK | Apolipoprotein A-IV | Plasma | 3701.8723 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2731 | AEDLVGKSLYVSATVILHSGSDMVQAER | Complement C3 | Plasma | 2974.507 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2732 | LESEETMVLEAHDAQGDVPVTVTVHDFPG | Complement C3 | Plasma | 3121.455 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2733 | SEETKENEGFTVTAEGKGQGTLSVVTMYHA | Complement C3 | Plasma | 3199.4979 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2734 | SEETKENEGFTVTAEGKGQGTLSVVTMYHA | Complement C3 | Plasma | 3215.4928 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2735 | LESEETMVLEAHDAQGDVPVTVTVHDFPGK | Complement C3 | Plasma | 3249.55 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2736 | LMNIFLKDSITTWEILAVSMSDKKGICVA | Complement C3 | Plasma | 3257.675 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2800 | GHRPLDKKREEAPSLRPAPPPISGGGY | Fibrinogen beta chain | Plasma | 2881.5311 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2801 | GDKVKAHYGGFTVQNEANKYQISVNK | Fibrinogen beta chain | Plasma | 2894.4675 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2802 | GHRPLDKKREEAPSLRPAPPPISGGGYR | Fibrinogen beta chain | Plasma | 3037.6322 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2803 | TMTIHNGMFFSTYDRDNDGWLTSDPR | Fibrinogen beta chain | Plasma | 3076.3444 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2840 | SVLGQLGITKVFSNGADLSGVTEEAPL | Alpha-1 protease inhibitor | Plasma | 2701.4174 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2843 | SVLGQLGITKVFSNGADLSGVTEEAPLK | Alpha-1 protease inhibitor | Plasma | 2829.5124 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2845 | AVLTIDEKGTEAAGAMFLEAIPMSIPPEV | Alpha-1 protease inhibitor | Plasma | 2999.5236 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2847 | SVLGQLGITKVFSNGADLSGVTEEAPLKLS | Alpha-1 protease inhibitor | Plasma | 3029.6285 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2848 | AVLTIDEKGTEAAGAMFLEAIPMSIPPEVK | Alpha-1 protease inhibitor | Plasma | 3127.6185 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2850 | LYHSEAFTVNFGDTEEAKKQINDYVEK | Alpha-1 protease inhibitor | Plasma | 3174.5146 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2851 | TDTSHHDQDHPTFNKITPNLAEFAFSLY | Alpha-1 protease inhibitor | Plasma | 3245.5054 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2853 | GKWERPFEVKDTEEEDFHVDQVTTVKVPM | Alpha-1 protease inhibitor | Plasma | 3474.6766 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2854 | GKWERPFEVKDTEEEDFHVDQVTTVKVPMM | Alpha-1 protease inhibitor | Plasma | 3605.7171 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2891 | LTYAYFAGGDAGDAFDGFDFGDDPSDK | Fibrinogen gamma | Plasma | 2833.1668 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2892 | QLIKAIQLTYNPDESSKPNMIDAATL | Fibrinogen gamma | Plasma | 2873.4845 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2893 | QLIKAIQLTYNPDESSKPNMIDAATLK | Fibrinogen gamma | Plasma | 3001.5794 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2894 | YRLTYAYFAGGDAGDAFDGFDFGDDPSDK | Fibrinogen gamma | Plasma | 3152.3312 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2923 | SILQMSLDHHIVTPLTSLVIENEAGDER | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 3116.5812 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2924 | QTVEAMKTILDDLRAEDHFSVIDFNQNIR | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 3417.6987 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2925 | MKQTVEAMKTILDDLRAEDHFSVIDFNQNI | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 3520.733 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2989 | DALSSVQESQVAQQARGWVTDGFSSL | Apolipoprotein C-III | Plasma | 2765.3257 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2990 | DALSSVQESQVAQQARGWVTDGFSSLK | Apolipoprotein C-III | Plasma | 2893.4206 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2991 | TAKDALSSVQESQVAQQARGWVTDGFSSL | Apolipoprotein C-III | Plasma | 3065.5054 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3010 | KAEEEHLGILGPQLHADVGDKVKIIF | Ceruloplasmin | Plasma | 2855.5545 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3034 | PGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 2723.382 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3035 | HRQGPVNLLSDPEQGVEVTGQYEREK | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 2964.469 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3036 | AISGGSIQIENGYFVHYFAPEGLTTMPK | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 3026.4848 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3037 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 3271.6349 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3038 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 3287.6298 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3049 | GMADQDGLKPTIDKPSEDSPPLEMLGPR | Inter-alpha-trypsin inhibitor heavy chain H1 | Plasma | 2993.4474 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3050 | GMADQDGLKPTIDKPSEDSPPLEMLGPRR | Inter-alpha-trypsin inhibitor heavy chain H1 | Plasma | 3149.5485 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3085 | RVAEGTQVLELPFKGDDITMVLILPKPEK | Antithrombin-III | Plasma | 3235.789 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3127 | TASDFITKMDYPKQTQVSVLPEGGETPLF | Gelsolin | Plasma | 3198.5795 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3156 | SVIRYTCEEPYYYMENGGGGEYHCAGN | Complement C1s subcomponent | Plasma | 3077.2266 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3172 | VLQIEKEGAIHREELVYELNPLDHRG | Complement C4-A | Plasma | 3056.6043 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3207 | TSESGELHGLTTEEEFVEGIYKVEIDTK | Transthyretin | Plasma | 3139.5085 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3213 | AHYDLRHTFMGVVSLGSPSGEVSHPR | Alpha-2-HS-glycoprotein | Plasma | 2835.3875 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3214 | AHYDLRHTFMGVVSLGSPSGEVSHPRKT | Alpha-2-HS-glycoprotein | Plasma | 3064.5301 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3221 | TSPVDEKALQDQLVLVAAKLDTEDKL | Angiotensinogen | Plasma | 2838.5226 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3222 | TSPVDEKALQDQLVLVAAKLDTEDKLR | Angiotensinogen | Plasma | 2994.6237 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3244 | VTEPISAESGEQVERVNEPSILEMSR | Apolipoprotein-L1 | Plasma | 2885.4077 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3401 | SWGGRPQRMGAVPGGVWSAVLMGGAR | Receptor tyrosine-protein kinase erbB-2 | Plasma | NA | Linear ion-trap mass spectrometer (LTQ) coupled with a Surveyor HPLC-MS | Breast cancer | Differentially expressed between normal and patients | 24565027 |
| CancerPDF_ID3415 | KGNSGEPGAPGSKGDTGAKGEPGPVG | Collagen type a1 | Urine | NA | LC-MS | CRLM( Colorectal liver metastses) | NA | 27186406 |
| CancerPDF_ID3492 | TGGPpGENGKPGEpGpKGDAGApGAP | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3493 | GPIGppGVRGSVGEAGpEGPPGEpGP | Collagen alpha-2(V) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3494 | GPpGKNGDDGEAGKpGRpGERGPPGP | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3496 | LAPEPLSAPPGSPPPSAAPTSATSNSSN | Homeobox protein Hox-B3 | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3497 | NRGERGSEGSPGHpGQPGPpGPPGApGP | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3498 | DGKTGPpGpAGQDGRPGPPGpPGARGQAG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3499 | ERGEAGIpGVpGAKGEDGKDGSpGEpGA | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3500 | DGVSGGEGKGGSDGGGSHRKEGEEADAPG | "CD99 antigen, CD99" | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3501 | GGEGKGGSDGGGSHRKEGEEADAPGVIPG | CD99 antigen | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3502 | EVEMKPDSSPSEVPEGVSETEGALQI | SH3 and multiple ankyrin repeat domains protein 2 | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3503 | GPPGESGREGApGAEGSPGRDGSPGAKGDR | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3505 | SPADKTNVKAAWGKVGAHAGEYGAEALER | Hemoglobin subunit alpha | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3506 | DGLQAAFTTAHELGHVFNMPHDDAKQCA | "A disintegrin and metalloproteinase with thrombospondin motifs 1, ADAMTS1" | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3507 | LTPEEKSAVTALWGKVNVDEVGGEALGRL | "Hemoglobin subunit beta, HBB" | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3516 | RERpQNQQpHRAQRSPQQqPSRLHRpQNQE | Collagen alpha-2(XI) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3724 | KGDAGApGApGGKGDAGApGERGpPG | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3725 | ANGApGNDGAKGDAGApGApGSQGAPG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3732 | PSGPpGPAGSPGERGAAGSGGPIGpPG | Collagen alpha-2(XI) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3736 | GANGApGNDGAKGDAGApGApGSQGApG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3737 | KGNSGEPGApGSKGDTGAKGEPGpVG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3742 | KGNSGEpGAPGSKGDTGAKGEpGpVG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3744 | KGNSGEpGApGSKGDTGAKGEpGpVG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3745 | GPIGppGVRGSVGEAGpEGPPGEpGP | Collagen alpha-2(V) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3750 | ADGQpGAKGEpGDAGAKGDAGPpGPAGP | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3754 | GMKGDPGLPGVPGFpGmKGpSGVPGSAG | Collagen alpha-5(IV) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3756 | ApGPAGSRGApGPQGpRGDKGETGERG | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3757 | GApGQNGEPGGKGERGApGEKGEGGppG | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3758 | PGVPGKDGQAGQpGQPGPKGDpGISGTP | Collagen alpha-1(IV) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3760 | pGKDGETGAAGPpGPAGPAGERGEqGApG | Collagen alpha-1(II) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3761 | LAPEPLSAPPGSPPPSAAPTSATSNSSN | Homeobox protein Hox-B3 | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3767 | SGHPGSPGSPGYQGPpGEPGQAGPSGPpGP | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3769 | SQYLSSVDSFGSPPTAAASQETDQLE | Protein fosB | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3771 | AVADTRDQADGSRASVDSGSSEEQGGSS | Polymeric immunoglobulin receptor | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3774 | GPPGESGREGApGAEGSPGRDGSPGAKGDR | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3775 | VQGPpGpAGEEGKRGARGEPGPTGLpGPpG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3777 | GRDGNpGNDGPpGRDGQpGHKGERGYpG | Collagen alpha-2(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3778 | RQQLPVGTTWGPFPGKmDLNNNSLKT | Zinc finger protein ZFPM2 | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3780 | ESELMRDAQLNDGAmETGTLYLAEEDP | Proenkephalin-B | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3781 | DGLQAAFTTAHELGHVFNMPHDDAKQCA | "A disintegrin and metalloproteinase with thrombospondin motifs 1, ADAMTS1" | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3786 | ATSVNSVTGIRIEDLPTSESTVHAQEQSPS | "Podoplanin, PDPN" | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3815 | RERpQNQQpHRAQRSPQQqPSRLHRpQNQE | Collagen alpha-2(XI) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3919 | PQQPQAPPAGQPQGPPRPPQGGRPSRPPQ | Basic PRP2 (Basic salivary proline-rich protein 2) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
| CancerPDF_ID3957 | YPPGPLAPPQPFGPGFVPPPPPPPYGPGR | Submaxillary gland androgen-regulated protein 3B | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
| CancerPDF_ID3959 | GPLAPPQPFGPGFVPPPPPPPYGPGR | Submaxillary gland androgen-regulated protein 3B | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
| CancerPDF_ID3962 | PGPLAPPQPFGPGFVPPPPPPPYGPGR | Submaxillary gland androgen-regulated protein 3B | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
| CancerPDF_ID3964 | YPPGPLAPPQPFGPGFVPPPPPPPYGPGR | Submaxillary gland androgen-regulated protein 3B | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
| CancerPDF_ID3991 | GPPPPPPGKPQGPPPQGGRPQGPPQGQSPQ | aPRP (phosphorylated acidic proline-rich proteins ) | Saliva | NA | LC-MS and iTRAQ | Normal | NA | 22809520 |
| CancerPDF_ID4046 | AAGAFQGLRQLDMLDLSNNSLASVPEGLWA | Leucine-rich alpha-2-glycoprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4051 | AAGQQQPPREPPAAPGAWRQQIQWENNGQV | Protein-lysine 6-oxidase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4065 | AAPEAQVSVQPNFQQDKFLGRWFSAGL | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4066 | AAPEAQVSVQPNFQQDKFLGRWFSAGL | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4096 | AAVPGKTFVNITPAEVGVLVGKDRSSF | Profilin-1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4098 | AAYLWVGTGASEAEKTGAQELLRVLRAQPV | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4112 | ADKPETTKEQLGEFYEALDCLRIPKSDV | Alpha-1-acid glycoprotein 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4119 | ADSPSKAGAAPYVQAFDSLLAGPVAEYLKI | Isoform 1 of Adenylyl cyclase-associated protein 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4144 | AFAQYLQQCPFEDHVKLVNEVTEFAKTC | Isoform 1 of Serum albumin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4149 | AFCKAQGFTEDTIVFLPQTDKCMTEQ | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4150 | AFCKAQGFTEDTIVFLPQTDKCMTEQ | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4166 | AGAFQGLRQLDMLDLSNNSLASVPEGLWA | Leucine-rich alpha-2-glycoprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4183 | AGPPGPPGPPGPPGVSGGGYDFGYDGD | Collagen alpha-2(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4184 | AGPPGPPGPPGPPGVSGGGYDFGYDGDFY | Collagen alpha-2(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4202 | AIDLPGLGHSKEAAAPAPIGELAPGSFL | Isoform 1 of Abhydrolase domain-containing protein 14B | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4215 | AIRNDEELNKLLGKVTIAQGGVLPNIQ | Histone H2A type 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4216 | AIRNDEELNKLLGKVTIAQGGVLPNIQ | Histone H2A type 1-D | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4217 | AIRNDEELNKLLGKVTIAQGGVLPNIQ | Histone H2A type 2-A | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4218 | AIRNDEELNKLLGKVTIAQGGVLPNIQA | Histone H2A type 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4219 | AIRNDEELNKLLGKVTIAQGGVLPNIQA | Histone H2A type 1-D | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4220 | AIRNDEELNKLLGKVTIAQGGVLPNIQA | Histone H2A type 2-A | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4221 | AIRNDEELNKLLGKVTIAQGGVLPNIQAV | Histone H2A type 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4222 | AIRNDEELNKLLGKVTIAQGGVLPNIQAV | Histone H2A type 1-D | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4223 | AIRNDEELNKLLGKVTIAQGGVLPNIQAV | Histone H2A type 2-A | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4241 | ALDFEQEMATAASSSSLEKSYELPDGQVI | "Actin, cytoplasmic 1" | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4291 | ANGAPGNDGAKGDAGAPGAPGSQGAPG | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4299 | ANKIADFELPTIIVPEQTIEIPSIKFSVPA | Apolipoprotein B-100 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4307 | APEAQVSVQPNFQQDKFLGRWFSAGL | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4309 | APGILGLPGSRGERGLPGVAGAVGEPGP | Collagen alpha-2(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4310 | APGILGLPGSRGERGLPGVAGAVGEPGPL | Collagen alpha-2(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4311 | APGILGLPGSRGERGLPGVAGAVGEPGPLG | Collagen alpha-2(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4325 | AQDFKTDLRFQSSAVMALQEACEAYLV | Histone H3.1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4352 | AQYLQQCPFEDHVKLVNEVTEFAKTC | Isoform 1 of Serum albumin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4393 | AVADTRDQADGSRASVDSGSSEEQGGSSRA | Polymeric immunoglobulin receptor | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4400 | AVGPPGFAGEKGPSGEAGTAGPPGTPGP | Collagen alpha-2(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4404 | AVHPSGVALQDRVPLASQGLGPGSTV | Interferon-induced 17 kDa protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4405 | AVHPSGVALQDRVPLASQGLGPGSTVL | Interferon-induced 17 kDa protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4459 | CLAKMYYSAVDPTKDIFTGLIGPMKI | Ceruloplasmin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4531 | CSNKIGRFVIEEVPGELMQEDLATDDVML | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4534 | CVGCPRDIPTNSPELEETLTHTITKL | Isoform LMW of Kininogen-1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4568 | DFEQEMATAASSSSLEKSYELPDGQVI | "Actin, cytoplasmic 1" | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4595 | DITATNHTNEIQDYLQQLTGARTVPRVFI | Glutaredoxin-1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4617 | DLFTSKGLFRAAVPSGASTGIYEALEL | Isoform alpha-enolase of Alpha-enolase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4619 | DLGEELEALKTELEDTLDSTAAQQEL | Isoform 1 of Myosin-9 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4640 | DLQAAPEAQVSVQPNFQQDKFLGRWF | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4641 | DLQAAPEAQVSVQPNFQQDKFLGRWFSAGL | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4680 | DTDGALWLGGLPELPVGPALPKAYGTGF | Agrin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4691 | DVNDEKNWGLSVYADKPETTKEQLGEF | Alpha-1-acid glycoprotein 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4700 | DWILRQRQDDLDTLGLGLQGGIPNGY | Isoform 2 of Mesothelin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4701 | DWILRQRQDDLDTLGLGLQGGIPNGYL | Isoform 2 of Mesothelin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4712 | EAEDLQVGQVELGGGPGAGSLQPLALEGSL | Insulin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4714 | EAEPLVDIRVTGPVPGALGAALWEAGSPV | Multimerin-2 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4740 | EICPSFQRVIETLLMDTPSSYEAAMEL | Uteroglobin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4742 | EIPEAQIHEGFQELLRTLNQPDSQLQLT | Isoform 1 of Alpha-1-antitrypsin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4752 | EKNLSDLIDLVPSLCEDLLSSVDQPLKI | Isoform 1 of F-actin-capping protein subunit beta | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4754 | ELDLSYNKLKNIPTVNENLENYYLEV | Lumican | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4786 | ETDYDQYALLYSQGSKGPGEDFRMAT | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4787 | ETDYDQYALLYSQGSKGPGEDFRMAT | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4821 | FDVNDEKNWGLSVYADKPETTKEQLGEF | Alpha-1-acid glycoprotein 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4843 | FGDTEEAKKQINDYVEKGTQGKIVDL | Isoform 1 of Alpha-1-antitrypsin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4862 | FGGKPMIIYKGGTSREGGQTAPASTRL | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4995 | FPPSSEELQANKATLVCLISDFYPGAVT | 25 kDa protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4996 | FPPSSEELQANKATLVCLISDFYPGAVT | 25 kDa protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4997 | FPPSSEELQANKATLVCLISDFYPGAVT | hypothetical protein XP_002348153 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4998 | FPPSSEELQANKATLVCLISDFYPGAVT | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4999 | FPPSSEELQANKATLVCLISDFYPGAVT | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5000 | FPPSSEELQANKATLVCLISDFYPGAVT | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5014 | FQVRANSAGATRAVEVLPKAGALNSNDA | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5025 | FSDGNSQGATPAAIEKAVQEAQRAGIEI | Collagen alpha-1(VI) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5039 | FSSSQELGAALAQLVAQRAACCLAGARA | 6-phosphogluconolactonase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5067 | FVLKTPSAAYLWVGTGASEAEKTGAQEL | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5088 | GAFQGLRQLDMLDLSNNSLASVPEGLWA | Leucine-rich alpha-2-glycoprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5093 | GAPGQNGEPGGKGERGAPGEKGEGGPPG | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5094 | GARGSAGPPGATGFPGAAGRVGPPGP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5132 | GGDAGDAFDGFDFGDDPSDKFFTSHNGMQF | Isoform Gamma-B of Fibrinogen gamma chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5174 | GIPEDSIFTMADRGECVPGEQEPEPI | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5175 | GIPEDSIFTMADRGECVPGEQEPEPIL | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5176 | GIPEDSIFTMADRGECVPGEQEPEPILIPR | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5183 | GIVMDSGDGVTHTVPIYEGYALPHAI | "Actin, cytoplasmic 1" | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5204 | GLINEALDEGDAQKTLQALQIPAAKLEGV | Ras GTPase-activating-like protein IQGAP1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5220 | GLSETEPGSFLYYAPFDGILGLAYPS | Pepsin A | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5259 | GPTGTGESKCPLMVKVLDAVRGSPAIN | Transthyretin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5260 | GPTGTGESKCPLMVKVLDAVRGSPAINVA | Transthyretin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5264 | GQPKAAPSVTLFPPSSEELQANKATL | hypothetical protein XP_002348153 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5265 | GQPKAAPSVTLFPPSSEELQANKATL | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5266 | GQPKAAPSVTLFPPSSEELQANKATL | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5267 | GQPKAAPSVTLFPPSSEELQANKATL | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5268 | GQPKAAPSVTLFPPSSEELQANKATLV | hypothetical protein XP_002348153 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5269 | GQPKAAPSVTLFPPSSEELQANKATLV | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5270 | GQPKAAPSVTLFPPSSEELQANKATLV | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5271 | GQPKAAPSVTLFPPSSEELQANKATLVCL | hypothetical protein XP_002348153 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5272 | GQPKAAPSVTLFPPSSEELQANKATLVCL | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5273 | GQPKAAPSVTLFPPSSEELQANKATLVCL | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5274 | GQPKAAPSVTLFPPSSEELQANKATLVCL | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5275 | GQPKAAPSVTLFPPSSEELQANKATLVCLI | hypothetical protein XP_002348153 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5276 | GQPKAAPSVTLFPPSSEELQANKATLVCLI | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5277 | GQPKAAPSVTLFPPSSEELQANKATLVCLI | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5299 | GSTGNRNPGSSGTGGTATWKPGSSGP | Isoform 1 of Fibrinogen alpha chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5351 | HAFDQQLDLELRPDSSFLAPGFTLQNV | A disintegrin and metalloproteinase with thrombospondin motifs 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5388 | HLTMPQLVLQGSYDLQDLLAQAELPA | Angiotensinogen | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5409 | IAAKFDGILGMAYPRISVNNVLPVFDNL | Cathepsin D | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5421 | IAVEWESNGQPENNYKTTPPVLDSDGSFF | Putative uncharacterized protein DKFZp686P15220 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5427 | IDLPGLGHSKEAAAPAPIGELAPGSF | Isoform 1 of Abhydrolase domain-containing protein 14B | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5428 | IDLPGLGHSKEAAAPAPIGELAPGSFL | Isoform 1 of Abhydrolase domain-containing protein 14B | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5451 | IFPPSDEQLKSGTASVVCLLNNFYPREA | 26 kDa protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5452 | IFPPSDEQLKSGTASVVCLLNNFYPREA | 26 kDa protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5453 | IFPPSDEQLKSGTASVVCLLNNFYPREA | Ig kappa chain C region | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5454 | IFPPSDEQLKSGTASVVCLLNNFYPREA | Ig kappa chain C region | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5455 | IFPPSDEQLKSGTASVVCLLNNFYPREA | IGKat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5456 | IFPPSDEQLKSGTASVVCLLNNFYPREA | IGKat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5457 | IFPPSDEQLKSGTASVVCLLNNFYPREA | IGKat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5458 | IFPPSDEQLKSGTASVVCLLNNFYPREA | Putative uncharacterized protein IGKC | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5463 | IGGAPDVATLTGGRFSSGITGCVKNL | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5491 | ILGLPGSRGERGLPGVAGAVGEPGPL | Collagen alpha-2(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5492 | ILGLPGSRGERGLPGVAGAVGEPGPLG | Collagen alpha-2(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5513 | IQVYSRHPAENGKSNFLNCYVSGFHPSD | Beta-2-microglobulin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5519 | IRLPYTASSGLMAPREVLTGNDEVIGQVL | V-type proton ATPase subunit S1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5540 | IVEEQYTPQSLATLESVFQELGKLTGPNNQ | Secretogranin-2 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5545 | IVNTNVPRASVPDGFLSELTQQLAQAT | Macrophage migration inhibitory factor | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5552 | IVVAGKFDPAKLDQIESVITATSANTQL | "Inter-alpha (Globulin) inhibitor H2, isoform CRA_a" | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5567 | IYTGLSKHVEDVPAFQALGSLNDLQFF | Zinc-alpha-2-glycoprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5593 | KFSRHHGPTITAKLYGRAPQLRETLL | Protein AMBP | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5595 | KGNSGEPGAPGSKGDTGAKGEPGPVG | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5596 | KGPSVFPLAPSSKSTSGGTAALGCLV | IGHat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5597 | KGPSVFPLAPSSKSTSGGTAALGCLV | Putative uncharacterized protein DKFZp686C11235 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5598 | KGPSVFPLAPSSKSTSGGTAALGCLV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5599 | KGPSVFPLAPSSKSTSGGTAALGCLV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5600 | KGPSVFPLAPSSKSTSGGTAALGCLV | Putative uncharacterized protein DKFZp686P15220 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5643 | KVQWKVDNALQSGNSQESVTEQDSKDSTY | 26 kDa protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5644 | KVQWKVDNALQSGNSQESVTEQDSKDSTY | 26 kDa protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5645 | KVQWKVDNALQSGNSQESVTEQDSKDSTY | Anti-RhD monoclonal T125 kappa light chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5646 | KVQWKVDNALQSGNSQESVTEQDSKDSTY | Ig kappa chain C region | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5647 | KVQWKVDNALQSGNSQESVTEQDSKDSTY | Ig kappa chain C region | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5648 | KVQWKVDNALQSGNSQESVTEQDSKDSTY | IGKat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5649 | KVQWKVDNALQSGNSQESVTEQDSKDSTY | IGKat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5650 | KVQWKVDNALQSGNSQESVTEQDSKDSTY | Putative uncharacterized protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5651 | KVQWKVDNALQSGNSQESVTEQDSKDSTY | Putative uncharacterized protein IGKC | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5652 | KVQWKVDNALQSGNSQESVTEQDSKDSTYSL | Ig kappa chain C region | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5653 | KVQWKVDNALQSGNSQESVTEQDSKDSTYSL | IGKat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5654 | KVQWKVDNALQSGNSQESVTEQDSKDSTYSL | IGKat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5655 | KVQWKVDNALQSGNSQESVTEQDSKDSTYSL | Putative uncharacterized protein IGKC | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5695 | LAPRDGVIIGLNPLPDVQVNDLRGALDA | Isoform 1 of Putative sodium-coupled neutral amino acid transporter 10 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5702 | LAVSQVVHKAVLDVFEEGTEASAATA | "cDNA FLJ35730 fis, clone TESTI2003131, highly similar to ALPHA-1-ANTICHYMOTRYPSIN" | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5703 | LAVSQVVHKAVLDVFEEGTEASAATAVK | "cDNA FLJ35730 fis, clone TESTI2003131, highly similar to ALPHA-1-ANTICHYMOTRYPSIN" | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5733 | LDNSRSNEGKLEGLTDEFEELEFLSTI | Acidic leucine-rich nuclear phosphoprotein 32 family member A | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5743 | LDVAPLSLGLETAGGVMTALIKRNSTIPT | Heat shock 70 kDa protein 1A/1B | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5751 | LELPPEESLPLGPLLGDTAVIQGDTAL | "N(G),N(G)-dimethylarginine dimethylaminohydrolase 2" | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5773 | LFPPSSEELQANKATLVCLISDFYPGAV | 25 kDa protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5774 | LFPPSSEELQANKATLVCLISDFYPGAV | 25 kDa protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5775 | LFPPSSEELQANKATLVCLISDFYPGAV | hypothetical protein XP_002348153 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5776 | LFPPSSEELQANKATLVCLISDFYPGAV | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5777 | LFPPSSEELQANKATLVCLISDFYPGAV | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5778 | LFPPSSEELQANKATLVCLISDFYPGAV | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5779 | LFPPSSEELQANKATLVCLISDFYPGAV | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5780 | LFPPSSEELQANKATLVCLISDFYPGAV | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5781 | LFPPSSEELQANKATLVCLISDFYPGAV | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5782 | LFPPSSEELQANKATLVCLISDFYPGAV | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5783 | LFPPSSEELQANKATLVCLISDFYPGAV | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5784 | LFPPSSEELQANKATLVCLISDFYPGAV | Putative uncharacterized protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5785 | LFPPSSEELQANKATLVCLISDFYPGAVT | 25 kDa protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5786 | LFPPSSEELQANKATLVCLISDFYPGAVT | 25 kDa protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5787 | LFPPSSEELQANKATLVCLISDFYPGAVT | hypothetical protein XP_002348153 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5788 | LFPPSSEELQANKATLVCLISDFYPGAVT | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5789 | LFPPSSEELQANKATLVCLISDFYPGAVT | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5790 | LFPPSSEELQANKATLVCLISDFYPGAVT | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5791 | LFPPSSEELQANKATLVCLISDFYPGAVT | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5792 | LFPPSSEELQANKATLVCLISDFYPGAVTV | 25 kDa protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5793 | LFPPSSEELQANKATLVCLISDFYPGAVTV | 25 kDa protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5794 | LFPPSSEELQANKATLVCLISDFYPGAVTV | hypothetical protein XP_002348153 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5795 | LFPPSSEELQANKATLVCLISDFYPGAVTV | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5796 | LFPPSSEELQANKATLVCLISDFYPGAVTV | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5797 | LFPPSSEELQANKATLVCLISDFYPGAVTV | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5798 | LFPPSSEELQANKATLVCLISDFYPGAVTV | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5799 | LFPPSSEELQANKATLVCLISDFYPGAVTV | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5800 | LFPPSSEELQANKATLVCLISDFYPGAVTV | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5801 | LFPPSSEELQANKATLVCLISDFYPGAVTV | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5802 | LFPPSSEELQANKATLVCLISDFYPGAVTV | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5803 | LFPPSSEELQANKATLVCLISDFYPGAVTV | Putative uncharacterized protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5833 | LGQPKAAPSVTLFPPSSEELQANKATLV | hypothetical protein XP_002348153 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5834 | LGQPKAAPSVTLFPPSSEELQANKATLV | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5835 | LGQPKAAPSVTLFPPSSEELQANKATLV | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5836 | LGQPKAAPSVTLFPPSSEELQANKATLV | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5837 | LGQPKAAPSVTLFPPSSEELQANKATLV | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5838 | LGQPKAAPSVTLFPPSSEELQANKATLV | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5839 | LGQPKAAPSVTLFPPSSEELQANKATLV | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5840 | LGQPKANPTVTLFPPSSEELQANKATLV | 25 kDa protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5841 | LGQPKANPTVTLFPPSSEELQANKATLV | 25 kDa protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5842 | LGQPKANPTVTLFPPSSEELQANKATLV | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5843 | LGTLDLSHNQLQSLPLLGQTLPALTVLDV | Platelet glycoprotein Ib alpha chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5881 | LIYDASNRATGIPARFSGSGSGTDFTLT | Rheumatoid factor D5 light chain (Fragment) | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5882 | LIYDASSRATGIPDRFSGSGSGTDFT | similar to hCG1686089 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5884 | LIYGASSRATGIPDRFSGSGSGTDFT | Ig kappa chain V-III region HAH | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5885 | LIYGASSRATGIPDRFSGSGSGTDFT | IGKat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5886 | LIYGASSRATGIPDRFSGSGSGTDFTLT | IGKat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5887 | LIYGASTRATGIPARFSGSGSGTEFT | Myosin-reactive immunoglobulin light chain variable region | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5902 | LKQVHPDTGISSKAMGIMNSFVNDIFERI | Histone H2B type 1-C/E/F/G/I | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5903 | LKQVHPDTGISSKAMGIMNSFVNDIFERI | Histone H2B type 1-K | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5904 | LKQVHPDTGISSKAMGIMNSFVNDIFERI | Histone H2B type 1-L | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5933 | LLRTLDLGENQLETLPPDLLRGPLQL | Leucine-rich alpha-2-glycoprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5934 | LLRTLDLGENQLETLPPDLLRGPLQLERL | Leucine-rich alpha-2-glycoprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5981 | LNEHTFCAGMSKYQEDTCYGDAGSAF | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5982 | LNEHTFCAGMSKYQEDTCYGDAGSAFAV | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5986 | LPGVAGAPGLPGPRGIPGPVGAAGATGARG | Collagen alpha-2(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6033 | LRLYQASPADSGEYVCRVLGSSVPLEASVL | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6040 | LRTLDLGENQLETLPPDLLRGPLQLE | Leucine-rich alpha-2-glycoprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6041 | LRTLDLGENQLETLPPDLLRGPLQLER | Leucine-rich alpha-2-glycoprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6042 | LRTLDLGENQLETLPPDLLRGPLQLERL | Leucine-rich alpha-2-glycoprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6046 | LRTLNQPDSQLQLTTGNGLFLSEGLK | Isoform 1 of Alpha-1-antitrypsin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6070 | LSRQELFPFGPGQGDLELEDGDDFVSPAL | Isoform 1 of Nidogen-1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6071 | LSRQELFPFGPGQGDLELEDGDDFVSPALE | Isoform 1 of Nidogen-1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6092 | LTGLPPGLFQASATLDTLVLKENQLEV | Leucine-rich alpha-2-glycoprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6098 | LTSDPRLPYKVLSVPESTPFTAVLKF | Ubiquitin-fold modifier 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6148 | LWVGTGASEAEKTGAQELLRVLRAQPV | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6164 | MAGMSGGPMGLAISAALKPALRSGVQQL | Apolipoprotein F precursor | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6190 | MGTYDDGATKLNDEARRLIADLGSTSI | Protein FAM3C | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6275 | NGAPGNDGAKGDAGAPGAPGSQGAPG | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6312 | NLNGIYYPGGSYDPRNNSPYEIENGVVWV | Isoform 1 of Fibrinogen alpha chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6409 | PMFIVNTNVPRASVPDGFLSELTQQLAQAT | Macrophage migration inhibitory factor | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6473 | QAKEPCVESLVSQYFQTVTDYGKDLMEKV | Apolipoprotein A-II | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6500 | QDIMNYIVPILVLPRVNEKLQKGFPLPTPA | Bactericidal permeability-increasing protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6505 | QEEDLPRPSISAEPGTVIPLGSHVTFV | Isoform 1 of Leukocyte-associated immunoglobulin-like receptor 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6530 | QGPPGEPGEPGASGPMGPRGPPGPPG | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6561 | QNPGSPRPGSTGTWNPGSSERGSAGH | Isoform 1 of Fibrinogen alpha chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6567 | QPKANPTVTLFPPSSEELQANKATLVCL | 25 kDa protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6568 | QPKANPTVTLFPPSSEELQANKATLVCL | 25 kDa protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6569 | QPKANPTVTLFPPSSEELQANKATLVCL | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6649 | REPGQDLVVLPLSITTDFIPSFRLVA | Complement C3f | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6670 | RGPPGPPGKNGDDGEAGKPGRPGERGPPGP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6699 | RLLLPGELAKHAVSEGTKAVTKYTSAK | Histone H2B type 1-K | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6700 | RLLLPGELAKHAVSEGTKAVTKYTSSK | Histone H2B type 1-C/E/F/G/I | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6701 | RLLLPGELAKHAVSEGTKAVTKYTSSK | Histone H2B type 1-L | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6719 | RNDEELNKLLGKVTIAQGGVLPNIQAV | Histone H2A type 2-A | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6776 | SCTTNCLAPLAKVIHDNFGIVEGLMTTV | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6777 | SDAGLTFTSSSGQQTAQRAELQCPQPAA | Complement C3f | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6779 | SDGQPGPPGPPGTAGFPGSPGAKGEVGP | Isoform 1 of Collagen alpha-1(III) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6825 | SFVGSDPSQFCGQQGSPLGRPPGQREFV | Complement C1r subcomponent-like protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6879 | SGPGSTGNRNPGSSGTGGTATWKPGSSGP | Isoform 1 of Fibrinogen alpha chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6970 | SLGGNYLLNIGPTKDGLIVPIFQERLLAV | Putative uncharacterized protein FUCA1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7014 | SNASCTTNCLAPLAKVIHDNFGIVEGLMT | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7015 | SNASCTTNCLAPLAKVIHDNFGIVEGLMTTV | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7023 | SNKIGRFVIEEVPGELMQEDLATDDV | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7024 | SNKIGRFVIEEVPGELMQEDLATDDVML | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7027 | SNLDFGVSDADIQELFAEFGTLKKAAV | THO complex 4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7088 | SSDFNSDTHSSTFDAGAGIALNDHFVKLI | Glyceraldehyde-3-phosphate dehydrogenase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7128 | SSSQELGAALAQLVAQRAACCLAGARA | 6-phosphogluconolactonase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7139 | SSVQESQVAQQARGWVTDGFSSLKDY | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7140 | SSVQESQVAQQARGWVTDGFSSLKDYWSTV | Apolipoprotein C-III | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7193 | SVVETDYDQYALLYSQGSKGPGEDFRMA | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7194 | SVVETDYDQYALLYSQGSKGPGEDFRMA | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7195 | SVVETDYDQYALLYSQGSKGPGEDFRMAT | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7196 | SVVETDYDQYALLYSQGSKGPGEDFRMAT | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7197 | SVVETDYDQYALLYSQGSKGPGEDFRMATL | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7198 | SVVETDYDQYALLYSQGSKGPGEDFRMATL | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7262 | SWNSGALTSGVHTFPAVLQSSGLYSL | IGHat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7263 | SWNSGALTSGVHTFPAVLQSSGLYSL | Putative uncharacterized protein DKFZp686C11235 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7264 | SWNSGALTSGVHTFPAVLQSSGLYSL | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7265 | SWNSGALTSGVHTFPAVLQSSGLYSL | Putative uncharacterized protein DKFZp686I04196 (Fragment) | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7266 | SWNSGALTSGVHTFPAVLQSSGLYSL | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7267 | SWNSGALTSGVHTFPAVLQSSGLYSL | Putative uncharacterized protein DKFZp686P15220 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7268 | SWNSGALTSGVHTFPAVLQSSGLYSLS | IGHat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7269 | SWNSGALTSGVHTFPAVLQSSGLYSLS | Putative uncharacterized protein DKFZp686C11235 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7270 | SWNSGALTSGVHTFPAVLQSSGLYSLS | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7271 | SWNSGALTSGVHTFPAVLQSSGLYSLS | Putative uncharacterized protein DKFZp686I04196 (Fragment) | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7272 | SWNSGALTSGVHTFPAVLQSSGLYSLS | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7273 | SWNSGALTSGVHTFPAVLQSSGLYSLS | Putative uncharacterized protein DKFZp686P15220 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7274 | SWNSGALTSGVHTFPAVLQSSGLYSLSS | IGHat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7275 | SWNSGALTSGVHTFPAVLQSSGLYSLSS | Putative uncharacterized protein DKFZp686C11235 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7276 | SWNSGALTSGVHTFPAVLQSSGLYSLSS | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7277 | SWNSGALTSGVHTFPAVLQSSGLYSLSS | Putative uncharacterized protein DKFZp686I04196 (Fragment) | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7278 | SWNSGALTSGVHTFPAVLQSSGLYSLSS | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7279 | SWNSGALTSGVHTFPAVLQSSGLYSLSS | Putative uncharacterized protein DKFZp686P15220 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7280 | SWNSGALTSGVHTFPAVLQSSGLYSLSSV | IGHat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7281 | SWNSGALTSGVHTFPAVLQSSGLYSLSSV | Putative uncharacterized protein DKFZp686C11235 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7282 | SWNSGALTSGVHTFPAVLQSSGLYSLSSV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7283 | SWNSGALTSGVHTFPAVLQSSGLYSLSSV | Putative uncharacterized protein DKFZp686I04196 (Fragment) | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7284 | SWNSGALTSGVHTFPAVLQSSGLYSLSSV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7285 | SWNSGALTSGVHTFPAVLQSSGLYSLSSV | Putative uncharacterized protein DKFZp686P15220 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7286 | SWNSGALTSGVHTFPAVLQSSGLYSLSSVV | IGHat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7287 | SWNSGALTSGVHTFPAVLQSSGLYSLSSVV | Putative uncharacterized protein DKFZp686C11235 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7288 | SWNSGALTSGVHTFPAVLQSSGLYSLSSVV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7289 | SWNSGALTSGVHTFPAVLQSSGLYSLSSVV | Putative uncharacterized protein DKFZp686I04196 (Fragment) | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7290 | SWNSGALTSGVHTFPAVLQSSGLYSLSSVV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7291 | SWNSGALTSGVHTFPAVLQSSGLYSLSSVV | Putative uncharacterized protein DKFZp686P15220 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7342 | TAFCKAQGFTEDTIVFLPQTDKCMTEQ | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7343 | TAFCKAQGFTEDTIVFLPQTDKCMTEQ | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7348 | TAQLDEELGGTPVQSRVVQGKEPAHL | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7366 | TDYDQYALLYSQGSKGPGEDFRMATL | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7367 | TDYDQYALLYSQGSKGPGEDFRMATL | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7376 | TFEYPSNAVEEVTQNNFRLLFKGSEMVV | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7378 | TFLSGGQSEEEASINLNAINKCPLLKPWALTF | Fructose-bisphosphate aldolase A | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7414 | TGSSPLGATQLDTDGALWLGGLPELPV | Agrin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7455 | TLAAHLPAEFTPAVHASLDKFLASVSTV | Hemoglobin subunit alpha | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7463 | TLDLGENQLETLPPDLLRGPLQLERL | Leucine-rich alpha-2-glycoprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7467 | TLDTPMNRKSMPEADFSSWTPLEFLVETF | Dihydropteridine reductase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7473 | TLFPPSSEELQANKATLVCLISDFYPGAVT | 25 kDa protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7474 | TLFPPSSEELQANKATLVCLISDFYPGAVT | 25 kDa protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7475 | TLFPPSSEELQANKATLVCLISDFYPGAVT | hypothetical protein XP_002348153 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7476 | TLFPPSSEELQANKATLVCLISDFYPGAVT | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7477 | TLFPPSSEELQANKATLVCLISDFYPGAVT | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7478 | TLFPPSSEELQANKATLVCLISDFYPGAVT | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7566 | TSEDGSDCPEAMDLGTLSGIGTLDGF | Isoform 1 of Fibrinogen alpha chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7567 | TSEDGSDCPEAMDLGTLSGIGTLDGFR | Isoform 1 of Fibrinogen alpha chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7568 | TSEPPAKESHPGLFPPTFGAVAPFLADL | Isoform 1 of Nidogen-1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7583 | TVLGQPKANPTVTLFPPSSEELQANKATLV | 25 kDa protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7584 | TVLGQPKANPTVTLFPPSSEELQANKATLV | 25 kDa protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7585 | TVLGQPKANPTVTLFPPSSEELQANKATLV | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7639 | TVSWNSGALTSGVHTFPAVLQSSGLY | IGHat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7640 | TVSWNSGALTSGVHTFPAVLQSSGLY | Putative uncharacterized protein DKFZp686C11235 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7641 | TVSWNSGALTSGVHTFPAVLQSSGLY | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7642 | TVSWNSGALTSGVHTFPAVLQSSGLY | Putative uncharacterized protein DKFZp686I04196 (Fragment) | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7643 | TVSWNSGALTSGVHTFPAVLQSSGLY | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7644 | TVSWNSGALTSGVHTFPAVLQSSGLY | Putative uncharacterized protein DKFZp686P15220 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7645 | TVSWNSGALTSGVHTFPAVLQSSGLYS | IGHat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7646 | TVSWNSGALTSGVHTFPAVLQSSGLYS | Putative uncharacterized protein DKFZp686C11235 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7647 | TVSWNSGALTSGVHTFPAVLQSSGLYS | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7648 | TVSWNSGALTSGVHTFPAVLQSSGLYS | Putative uncharacterized protein DKFZp686I04196 (Fragment) | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7649 | TVSWNSGALTSGVHTFPAVLQSSGLYS | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7650 | TVSWNSGALTSGVHTFPAVLQSSGLYS | Putative uncharacterized protein DKFZp686P15220 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7651 | TVSWNSGALTSGVHTFPAVLQSSGLYSL | IGHat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7652 | TVSWNSGALTSGVHTFPAVLQSSGLYSL | Putative uncharacterized protein DKFZp686C11235 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7653 | TVSWNSGALTSGVHTFPAVLQSSGLYSL | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7654 | TVSWNSGALTSGVHTFPAVLQSSGLYSL | Putative uncharacterized protein DKFZp686I04196 (Fragment) | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7655 | TVSWNSGALTSGVHTFPAVLQSSGLYSL | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7656 | TVSWNSGALTSGVHTFPAVLQSSGLYSL | Putative uncharacterized protein DKFZp686P15220 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7657 | TVSWNSGALTSGVHTFPAVLQSSGLYSLSS | IGHat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7658 | TVSWNSGALTSGVHTFPAVLQSSGLYSLSS | Putative uncharacterized protein DKFZp686C11235 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7659 | TVSWNSGALTSGVHTFPAVLQSSGLYSLSS | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7660 | TVSWNSGALTSGVHTFPAVLQSSGLYSLSS | Putative uncharacterized protein DKFZp686I04196 (Fragment) | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7661 | TVSWNSGALTSGVHTFPAVLQSSGLYSLSS | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7662 | TVSWNSGALTSGVHTFPAVLQSSGLYSLSS | Putative uncharacterized protein DKFZp686P15220 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7688 | TYIYTGLSKHVEDVPAFQALGSLNDL | Zinc-alpha-2-glycoprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7689 | TYIYTGLSKHVEDVPAFQALGSLNDLQ | Zinc-alpha-2-glycoprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7690 | TYIYTGLSKHVEDVPAFQALGSLNDLQF | Zinc-alpha-2-glycoprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7691 | TYIYTGLSKHVEDVPAFQALGSLNDLQFF | Zinc-alpha-2-glycoprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7705 | VAGAPGLPGPRGIPGPVGAAGATGARG | Collagen alpha-2(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7706 | VAIDLPGLGHSKEAAAPAPIGELAPGSFL | Isoform 1 of Abhydrolase domain-containing protein 14B | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7724 | VAWKADSSPVKAGVETTTPSKQSNNKYA | hypothetical protein XP_002348153 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7725 | VAWKADSSPVKAGVETTTPSKQSNNKYA | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7726 | VAWKADSSPVKAGVETTTPSKQSNNKYA | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7727 | VAWKADSSPVKAGVETTTPSKQSNNKYAAS | hypothetical protein XP_002348153 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7728 | VAWKADSSPVKAGVETTTPSKQSNNKYAAS | IGLat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7729 | VAWKADSSPVKAGVETTTPSKQSNNKYAAS | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7758 | VDITATNHTNEIQDYLQQLTGARTVPRVF | Glutaredoxin-1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7793 | VETDYDQYALLYSQGSKGPGEDFRMA | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7794 | VETDYDQYALLYSQGSKGPGEDFRMA | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7795 | VETDYDQYALLYSQGSKGPGEDFRMAT | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7796 | VETDYDQYALLYSQGSKGPGEDFRMAT | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7797 | VETDYDQYALLYSQGSKGPGEDFRMATL | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7798 | VETDYDQYALLYSQGSKGPGEDFRMATL | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7802 | VEVLPKAGALNSNDAFVLKTPSAAYL | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7841 | VGPPGFAGEKGPSGEAGTAGPPGTPGP | Collagen alpha-2(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7845 | VGPPGPPGPPGPPGPPSAGFDFSFLPQPP | Collagen alpha-1(I) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7847 | VGSDPSQFCGQQGSPLGRPPGQREFV | Complement C1r subcomponent-like protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7859 | VKLSSGAKVLATLCGQESTDTERAPGKD | Isoform 1 of Mannan-binding lectin serine protease 2 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7865 | VLALLKTPAQFDADELRAAMKGLGTDEDTL | Annexin A1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7866 | VLAPDGSTVAVEPLLAGLEAGLQGRRVI | Isoform 1 of N-acetylmuramoyl-L-alanine amidase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7944 | VLQSSGLYSLSSVVTVPSSSLGTQTYICNV | IGHat protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7945 | VLQSSGLYSLSSVVTVPSSSLGTQTYICNV | Putative uncharacterized protein DKFZp686C11235 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7946 | VLQSSGLYSLSSVVTVPSSSLGTQTYICNV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7947 | VLQSSGLYSLSSVVTVPSSSLGTQTYICNV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7948 | VLQSSGLYSLSSVVTVPSSSLGTQTYICNV | Putative uncharacterized protein DKFZp686P15220 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7977 | VQGPEGKLGPLGAPGEDGRPGPPGSIG | Collagen alpha-2(V) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8075 | VVETDYDQYALLYSQGSKGPGEDFRMA | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8076 | VVETDYDQYALLYSQGSKGPGEDFRMA | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8077 | VVETDYDQYALLYSQGSKGPGEDFRMATL | Prostaglandin D2 synthase 21kDa | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8078 | VVETDYDQYALLYSQGSKGPGEDFRMATL | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8079 | VVETDYDQYALLYSQGSKGPGEDFRMATLY | Prostaglandin-H2 D-isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8110 | VYSAAILEYLTAEVLELAGNASKDLKVK | Histone H2A.V | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8116 | WASHEKMHEGDEGPGHHHKPGLGEGTP | Protein S100-A9 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8174 | WQGVEVGEAGQGKDFISLGLQDGHLV | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8195 | WVGTGASEAEKTGAQELLRVLRAQPV | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8224 | YAASSLQSGVPSRFSGSGSGTDFTLTI | 26 kDa protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8241 | YDASNLETGVPSRFSGSGSGTDFTFTI | Ig kappa chain V-I region AU | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8284 | YIGGAPDVATLTGGRFSSGITGCVKNLVL | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8289 | YIYTGLSKHVEDVPAFQALGSLNDLQ | Zinc-alpha-2-glycoprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8290 | YIYTGLSKHVEDVPAFQALGSLNDLQF | Zinc-alpha-2-glycoprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8291 | YIYTGLSKHVEDVPAFQALGSLNDLQFF | Zinc-alpha-2-glycoprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8320 | YLWVGTGASEAEKTGAQELLRVLRAQPV | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8376 | YSRHPAENGKSNFLNCYVSGFHPSDIE | Beta-2-microglobulin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8377 | YSRHPAENGKSNFLNCYVSGFHPSDIEVD | Beta-2-microglobulin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8378 | YSRHPAENGKSNFLNCYVSGFHPSDIEVDL | Beta-2-microglobulin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8385 | YTGLSKHVEDVPAFQALGSLNDLQFF | Zinc-alpha-2-glycoprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8394 | YVNGLTLGGQKCSVIRDSLLQDGEFSMDL | Profilin-1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8518 | SSSYSKQFTSSTSYNRGDSTFESKSY | Fibrinogen alpha | Serum | 2930.28 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8519 | SSSYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha | Serum | 3189.42 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8525 | SYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha | Serum | 3238.52 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8529 | KMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha | Serum | 2988.42 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8530 | MADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha | Serum | 2874.34 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8531 | MADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha | Serum | 2860.33 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8532 | MADEAGSEADHEGTHSTKRGHAKSRP | Fibrinogen alpha | Serum | 2761.26 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8534 | ADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha | Serum | 2729.29 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8543 | GSESGIFTNTKESSSHHPGIAEFPSRG | Fibrinogen alpha | Serum | 2815.32 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8560 | GLEEELQFSLGSKINVKVGGNSKGTLKVLR | Complement C3f | Serum | 3199.79 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8561 | GLEEELQFSLGSKINVKVGGNSKGTL | Complement C3f | Serum | 2703.44 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8564 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 3271.63 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8565 | PGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 2723.38 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8576 | NVHSGSTFFKYYLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 3155.62 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8578 | AELQEGARQKLHELQEKLSPLGEEMRDRA | Aplipoprotein A-I | Serum | 3374.74 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8579 | QGLLPVLESFKVSFLSALEEYTKKLNTQ | Aplipoprotein A-I | Serum | 3181.73 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8587 | DSGPRRYTIAALLSPYSYSTTAVVTNPKE | Transthyretin | Serum | 3156.61 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8614 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter- trypsin inhibitor heavy chain H4 (ITIH4) fragment | Serum | 3273.69 | MALDI-TOF | Breast cancer | Upregulated in cancer as compare to normal control with fold change of 1.7 | 26705257 |
| CancerPDF_ID8619 | FLGDRDFNQFSSGEKNIFLASFVHEYSR | Fetoprotein (AFP) precursor | Serum | 3315.21 | MALDI-TOF | Breast cancer | Downregulated in cancer as compare to normal control with fold change of 1.6 | 26705257 |
| CancerPDF_ID8647 | SGPRRYTIAALLSPYSYSTTAVVTNPKE | Transthretin ( Cterminal fragment of protein TTHY) | Cerbrospinal fluid | NA | MALDI-TOF | Glioblastoma (Malignant brain tumor) | Upregulated in cancer as compare to normal control | 19674866 |
| CancerPDF_ID8689 | AGSWNSGSSGPGSTGNRNPGSSGTGGTA | Isoform 1 of Fibrinogen alpha chain | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8885 | GNEITRGGSTSYGTGSETESPRNPSSA | Isoform 1 of Fibrinogen alpha chain | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8889 | GNPEQTPVLKPEEEAPAPEVGASKPEG | Vitronectin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8915 | GSTGSWNSGSSGTGSTGNQNPGSPRPGS | Isoform 1 of Fibrinogen alpha chain | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8916 | GSTGSWNSGSSGTGSTGNQNPGSPRPGSTG | Isoform 1 of Fibrinogen alpha chain | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8920 | GSWNSGSSGPGSTGNRNPGSSGTGGTA | Isoform 1 of Fibrinogen alpha chain | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8973 | INKAVGDKLPECEADDGCPKPPEIAH | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9086 | NEITRGGSTSYGTGSETESPRNPSSA | Isoform 1 of Fibrinogen alpha chain | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9191 | QRQCNNPPPQNGGSPCSGPASETLDCS | Complement component C8 beta chain | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9277 | SWNSGSSGPGSTGNRNPGSSGTGGTA | Isoform 1 of Fibrinogen alpha chain | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9339 | TVIGPDGHKEVTKEVVTSEDGSDCPEA | Isoform 1 of Fibrinogen alpha chain | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9429 | WNSGSSGTGSTGNQNPGSPRPGSTGT | Isoform 1 of Fibrinogen alpha chain | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9514 | KPFVFLMIEQNTKSPLFMGKVVNPTQK | Alpha-1-antitrypsin | Serum | 781.17 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9550 | AELQEGARQKLHELQEKLSPLGEEMRD | Apolipoprotein A-I | Serum | 784.41 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9551 | AELQEGARQKLHELQEKLSPLGEEMRDRA | Apolipoprotein A-I | Serum | 841.19 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9572 | GNTEGLQKSLAELGGHLDQQVEEFRR | Apolipoprotein A-IV | Serum | 728.62 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9590 | EEAGARVQQNVPSGTDTGDPQSKPLG | Apolipoprotein L1 | Serum | 880.07 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9628 | SQTSQAVTGGHTQIQAGSHTETVEQDR | Cornulin | Serum | 714.09 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9645 | TAFGGRRAVPPNNSNAAEDDLPTVELQGVVPR | Coagulation factor XIII A chain | Serum | 837.66 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9707 | GDSTFESKSYKMADEAGSEADHEGTHST | Fibrinogen alpha chain | Serum | 744.3 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9708 | KMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Serum | 748.1 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9709 | GDSTFESKSYKMADEAGSEADHEGTHST | Fibrinogen alpha chain | Serum | 748.3 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9710 | SYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Serum | 810.62 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9711 | NRGDSTFESKSYKMADEAGSEADHEGTHST | Fibrinogen alpha chain | Serum | 811.9 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9712 | SYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Serum | 814.61 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9728 | SSSYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha chain | Serum | 798.36 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9759 | ESKSYKMADEAGSEADHEGTHSTKRGHA | Fibrinogen alpha chain | Serum | 754.84 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9760 | ESKSYKMADEAGSEADHEGTHSTKRGHA | Fibrinogen alpha chain | Serum | 758.86 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9761 | NRGDSTFESKSYKMADEAGSEADHEGTHST | Fibrinogen alpha chain | Serum | 815.87 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9816 | PGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 681.83 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9828 | GGSGGGGGGSSGGRGSGGGSSGGSIGGR | "Keratin, type II cytoskeletal 1" | Serum | 693.97 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9832 | AIGGGLSSVGGGSSTIKYTTTSSSSR | "Keratin, type II cytoskeletal 6A" | Serum | 806.74 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9911 | DSGPRRYTIAALLSPYSYSTTAVVTNPKE | Transthyretin | Serum | 790.14 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9913 | SGPRRYTIAALLSPYSYSTTAVVTNPKE | Transthyretin | Serum | 761.42 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9922 | GPPPQGGNKPQGPPPPGKPQGPPPQGDKS | Basic salivary proline-rich protein 2 | Saliva | 3135.59 | MALDI-TOF | Head and neck cancer | Differentially expressed between Head and neck cancer vs control groups | 20879038 |
| CancerPDF_ID9941 | PGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | NA | 21124649 |
| CancerPDF_ID9942 | RPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | NA | 21124649 |
| CancerPDF_ID9943 | FRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | NA | 21124649 |
| CancerPDF_ID9944 | NFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21124649 |
| CancerPDF_ID9945 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21124649 |
| CancerPDF_ID9949 | PGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21137033 |
| CancerPDF_ID9950 | RPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21137033 |
| CancerPDF_ID9951 | FRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21137033 |
| CancerPDF_ID9952 | NFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21137033 |
| CancerPDF_ID9953 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21137033 |
| CancerPDF_ID10475 | AGGGAGGGGAGGGGSPPGGWAVARLEG | Forkhead box protein K2 | Urine | 2136.9535 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10476 | GGAGLTGGGTAAGVAGAAAGVAGAAVAGP | Ras GTPase-activating protein 1 | Urine | 2137.0737 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10494 | LSAEGGGSAGGGGGAGAGVASGPELLD | SH3 and multiple ankyrin repeat domains protein 1 | Urine | 2170.9832 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10528 | GEVGAPGSKGEAGPTGPMGAMGPLGP | Collagen alpha-2(V) chain | Urine | 2279.0635 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10576 | GSTGSWNSGSSGTGSTGNQNPGSPRP | Fibrinogen alpha chain | Urine | 2434.0611 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10581 | VRVTASDPLDTLGSEGALSPGGVASL | Complement C4-A | Urine | 2469.2767 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10586 | VSGGEGKGGSDGGGSHRKEGEEADAPG | CD99 antigen | Urine | 2484.1098 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10627 | SPADKTNVKAAWGKVGAHAGEYGAEAL | Hemoglobin subunit alpha | Urine | 2698.3394 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10631 | VLSPADKTNVKAAWGKVGAHAGEYGAE | Hemoglobin subunit alpha | Urine | 2726.3911 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10632 | QAQSKGNPEQTPVLKPEEEAPAPEVG | Vitronectin | Urine | 2730.3391 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10633 | GSTGSWNSGSSGTGSTGNQNPGSPRPGSTG | Fibrinogen alpha chain | Urine | 2736.1753 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10640 | TAQLDEELGGTPVQSRVVQGKEPAHL | Gelsolin | Urine | 2759.4407 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10644 | FGGKPMIIYKGGTSREGGQTAPASTRL | Gelsolin | Urine | 2780.4268 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10646 | AAHLPAEFTPAVHASLDKFLASVSTVL | Hemoglobin subunit alpha | Urine | 2792.4821 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10647 | VLSPADKTNVKAAWGKVGAHAGEYGAEA | Hemoglobin subunit alpha | Urine | 2797.431 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10649 | WVHGLSKEQTSVSGAQKGRKQGGSQSS | Semenogelin-1 | Urine | 2814.4246 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10651 | FQVRANSAGATRAVEVLPKAGALNSNDA | Gelsolin | Urine | 2827.4844 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10654 | IPVKQADSGSSEEKQLYNKYPDAVAT | Osteopontin | Urine | 2838.4087 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10656 | PSRGKSSSYSKQFTSSTSYNRGDSTF | Fibrinogen alpha chain | Urine | 2862.3212 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10657 | IYTGLSKHVEDVPAFQALGSLNDLQF | Zinc-alpha-2-glycoprotein | Urine | 2862.4487 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10659 | VADTRDQADGSRASVDSGSSEEQGGSSRA | Polymeric immunoglobulin receptor | Urine | 2882.2712 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10661 | VAWKADSSPVKAGVETTTPSKQSNNKY | Ig lambda chain C regions | Urine | 2893.4888 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10663 | LVTLAAHLPAEFTPAVHASLDKFLASVS | Hemoglobin subunit alpha | Urine | 2905.5638 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10664 | VLSPADKTNVKAAWGKVGAHAGEYGAEAL | Hemoglobin subunit alpha | Urine | 2910.5136 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10665 | VKHQTVPQNTGGKNPDPWAKNLNEKD | Serotransferrin precursor | Urine | 2915.4496 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10666 | APEAQVSVQPNFQQDKFLGRWFSAGL | Prostaglandin-H2 D-isomerase | Urine | 2920.478 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10667 | TPEEKSAVTALWGKVNVDEVGGEALGRL | Hemoglobin subunit beta | Urine | 2925.5337 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10668 | SALSDLHAHKLRVDPVNFKLLSHCLL | Hemoglobin subunit alpha | Urine | 2926.6099 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10669 | YMKHATKTAKDALSSVQESQVAQQARG | Apolipoprotein C-III | Urine | 2933.4811 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10670 | DAHKSEVAHRFKDLGEENFKALVLIA | Serum albumin precursor | Urine | 2937.554 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10671 | VHLTPEEKSAVTALWGKVNVDEVGGEAL | Hemoglobin subunit beta | Urine | 2948.5494 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10672 | AVADTRDQADGSRASVDSGSSEEQGGSSRA | Polymeric immunoglobulin receptor | Urine | 2953.2677 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10673 | SQFPHGQKGQHYSGQKGKQQTESKGSF | Semenogelin-1 | Urine | 2991.4467 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10676 | KVEIDTKSYWKALGISPFHEHAEVVF | Transthyretin | Urine | 3030.571 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10678 | GHRPLDKKREEAPSLRPAPPPISGGGYR | Fibrinogen beta chain | Urine | 3038.6362 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10679 | FVKHQTVPQNTGGKNPDPWAKNLNEKD | Serotransferrin precursor | Urine | 3062.5133 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10680 | VDLLKNGERIEKVEHSDLSFSKDWSF | Beta-2-microglobulin | Urine | 3078.5558 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10682 | VTLAAHLPAEFTPAVHASLDKFLASVSTVL | Hemoglobin subunit alpha | Urine | 3105.6885 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10683 | VKDYFPEPVTVSWNSGALTSGVHTFPAVL | Ig gamma-1 chain C region | Urine | 3118.5887 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10684 | FSQFPHGQKGQHYSGQKGKQQTESKGSF | Semenogelin-1 | Urine | 3138.4767 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10685 | GTFATLSELHCDKLHVDPENFRLLGNVL | Hemoglobin subunit beta | Urine | 3138.5392 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10686 | IVITEHEVAQDDHLTQQYNEDRNPIST | Semenogelin-2 | Urine | 3165.4837 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10687 | IEVDLLKNGERIEKVEHSDLSFSKDWS | Beta-2-microglobulin | Urine | 3173.6186 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10688 | AKVQWKVDNALQSGNSQESVTEQDSKDST | Ig kappa chain C region | Urine | 3179.5088 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10689 | VAHVDDMPNALSALSDLHAHKLRVDPVNF | Hemoglobin subunit alpha | Urine | 3181.6283 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10691 | VSETESRGSESGIFTNTKESSSHHPGIAEF | Fibrinogen alpha chain | Urine | 3207.4794 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10693 | LTKKFSRHHGPTITAKLYGRAPQLRETL | Protein AMBP | Urine | 3219.8119 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10694 | EEVSGNVSPGTRREYHTEKLVTSKGDKEL | Fibrinogen alpha chain | Urine | 3245.6466 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10695 | LGRHSLFHPEDTGQVFQVSHSFPHPLYD | Prostate-specific antigen | Urine | 3247.5536 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10699 | AEYHAKATEHLSTLSEKAKPALEDLRQGLL | Apolipoprotein A-I | Urine | 3319.7917 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10700 | IEVDLLKNGERIEKVEHSDLSFSKDWSF | Beta-2-microglobulin | Urine | 3320.6998 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10702 | PYQYPALTPEQKKELSDIAHRIVAPGKGIL | Fructose-bisphosphate aldolase A | Urine | 3332.8627 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10704 | VDLLKNGERIEKVEHSDLSFSKDWSFYL | Beta-2-microglobulin | Urine | 3354.7279 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10705 | EDPQGDAAQKTDTSHHDQDHPTFNKITPNL | Alpha-1-antitrypsin | Urine | 3357.5577 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10708 | VAHVDDMPNALSALSDLHAHKLRVDPVNFKL | Hemoglobin subunit alpha | Urine | 3422.8282 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10711 | IEVDLLKNGERIEKVEHSDLSFSKDWSFY | Beta-2-microglobulin | Urine | 3483.7427 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10713 | AHHFGKEFTPPVQAAYQKVVAGVANALAHKYH | Hemoglobin subunit beta | Urine | 3486.8198 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10876 | PGDAGAKGDAGPPGPAGPAGPPGPIG | Collagen alpha-1(I) chain | Urine | 2151.0303 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10893 | NGAPGNDGAKGDAGAPGAPGSQGAPG | Collagen alpha-1(I) chain | Urine | 2211.9426 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10900 | GADGQPGAKGEPGDAGAKGDAGPPGP | Collagen alpha-1(I) chain | Urine | 2247.0131 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10902 | GADGQPGAKGEPGDAGAKGDAGPPGP | Collagen alpha-1(I) chain | Urine | 2263.014 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10903 | KGDAGAPGAPGGKGDAGAPGERGPPG | Collagen alpha-1(III) chain | Urine | 2265.0274 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10905 | ADGQPGAKGEPGDAGAKGDAGPPGPA | Collagen alpha-1(I) chain | Urine | 2277.0228 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10906 | GADGQPGAKGEPGDAGAKGDAGPPGP | Collagen alpha-1(I) chain | Urine | 2279.0018 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10907 | ANGAPGNDGAKGDAGAPGAPGSQGAPG | Collagen alpha-1(I) chain | Urine | 2282.9953 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10909 | ADGQPGAKGEPGDAGAKGDAGPPGPA | Collagen alpha-1(I) chain | Urine | 2293.0049 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10910 | RTGDAGPVGPPGPPGPPGPPGPPSAG | Collagen alpha-1(I) chain | Urine | 2307.0867 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10913 | AGPPGEAGKPGEQGVPGDLGAPGPSG | Collagen alpha-1(I) chain | Urine | 2320.0655 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10916 | GADGQPGAKGEPGDAGAKGDAGPPGPA | Collagen alpha-1(I) chain | Urine | 2334.0496 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10917 | GANGAPGNDGAKGDAGAPGAPGSQGAPG | Collagen alpha-1(I) chain | Urine | 2340.023 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10918 | GADGQPGAKGEPGDAGAKGDAGPPGPA | Collagen alpha-1(I) chain | Urine | 2350.0263 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10919 | KGNSGEPGAPGSKGDTGAKGEPGPVG | Collagen alpha-1(I) chain | Urine | 2356.0992 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10924 | LDGAKGDAGPAGPKGEPGSPGENGAPG | Collagen alpha-1(I) chain | Urine | 2408.0796 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10925 | RGGAGPPGPEGGKGAAGPPGPPGAAGTPG | Collagen alpha-1(III) chain | Urine | 2413.113 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10927 | LDGAKGDAGPAGPKGEPGSPGENGAPG | Collagen alpha-1(I) chain | Urine | 2424.0752 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10928 | ADGQPGAKGEPGDAGAKGDAGPPGPAGP | Collagen alpha-1(I) chain | Urine | 2431.0989 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10930 | TGPIGPPGPAGAPGDKGESGPSGPAGPTG | Collagen alpha-1(I) chain | Urine | 2472.148 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10932 | PPGESGREGAPGAEGSPGRDGSPGAKG | Collagen alpha-1(I) chain | Urine | 2482.1157 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10933 | GADGQPGAKGEPGDAGAKGDAGPPGPAGP | Collagen alpha-1(I) chain | Urine | 2488.1186 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10934 | PPGADGQPGAKGEPGDAGAKGDAGPPGP | Collagen alpha-1(I) chain | Urine | 2489.1067 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10935 | RGANGAPGNDGAKGDAGAPGAPGSQGAPG | Collagen alpha-1(I) chain | Urine | 2496.0978 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10936 | PPGESGREGAPGAEGSPGRDGSPGAKG | Collagen alpha-1(I) chain | Urine | 2498.1007 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10937 | GPPGKNGDDGEAGKPGRPGERGPPGP | Collagen alpha-1(I) chain | Urine | 2501.1697 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10938 | GADGQPGAKGEPGDAGAKGDAGPPGPAGP | Collagen alpha-1(I) chain | Urine | 2504.1284 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10939 | APGQNGEPGGKGERGAPGEKGEGGPPG | Collagen alpha-1(III) chain | Urine | 2508.1252 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10940 | GPPGKNGDDGEAGKPGRPGERGPPGP | Collagen alpha-1(I) chain | Urine | 2517.1546 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10942 | APGQNGEPGGKGERGAPGEKGEGGPPG | Collagen alpha-1(III) chain | Urine | 2524.1102 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10943 | LRGGAGPPGPEGGKGAAGPPGPPGAAGTPG | Collagen alpha-1(III) chain | Urine | 2526.2258 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10945 | LRGGAGPPGPEGGKGAAGPPGPPGAAGTPG | Collagen alpha-1(III) chain | Urine | 2542.2087 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10946 | GPPGADGQPGAKGEPGDAGAKGDAGPPGP | Collagen alpha-1(I) chain | Urine | 2546.1376 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10947 | GAPGQNGEPGGKGERGAPGEKGEGGPPG | Collagen alpha-1(III) chain | Urine | 2549.1613 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10948 | KNGETGPQGPPGPTGPGGDKGDTGPPGP | Collagen alpha-1(III) chain | Urine | 2558.1569 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10949 | PPGADGQPGAKGEPGDAGAKGDAGPPGPA | Collagen alpha-1(I) chain | Urine | 2560.1518 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10950 | GAPGQNGEPGGKGERGAPGEKGEGGPPG | Collagen alpha-1(III) chain | Urine | 2565.1498 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10951 | AGPPGAPGAPGAPGPVGPAGKSGDRGETGP | Collagen alpha-1(I) chain | Urine | 2568.239 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10952 | GAPGQNGEPGGKGERGAPGEKGEGGPPG | Collagen alpha-1(III) chain | Urine | 2581.145 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10953 | AGPPGAPGAPGAPGPVGPAGKSGDRGETGP | Collagen alpha-1(I) chain | Urine | 2584.272 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10954 | PPGKNGDDGEAGKPGRPGERGPPGPQ | Collagen alpha-1(I) chain | Urine | 2588.208 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10955 | AGPPGAPGAPGAPGPVGPAGKSGDRGETGP | Collagen alpha-1(I) chain | Urine | 2600.223 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10956 | GPPGADGQPGAKGEPGDAGAKGDAGPPGPA | Collagen alpha-1(I) chain | Urine | 2617.1733 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10957 | ARGPAGPPGKAGEDGHPGKPGRPGERG | Collagen alpha-2(I) chain | Urine | 2626.2534 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10958 | QGPPGPSGEEGKRGPNGEAGSAGPPGPPG | Collagen alpha-2(I) chain | Urine | 2627.1788 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10959 | GLPGPAGPPGEAGKPGEQGVPGDLGAPGP | Collagen alpha-1(I) chain | Urine | 2629.2181 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10960 | KEGGKGPRGETGPAGRPGEVGPPGPPGP | Collagen alpha-1(I) chain | Urine | 2640.2889 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10961 | KEGGKGPRGETGPAGRPGEVGPPGPPGP | Collagen alpha-1(I) chain | Urine | 2640.2997 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10962 | ARGPAGPPGKAGEDGHPGKPGRPGERG | Collagen alpha-2(I) chain | Urine | 2642.2717 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10963 | QGPPGPSGEEGKRGPNGEAGSAGPPGPPG | Collagen alpha-2(I) chain | Urine | 2643.1969 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10964 | GPPGKNGDDGEAGKPGRPGERGPPGPQ | Collagen alpha-1(I) chain | Urine | 2645.2344 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10965 | NRGERGSEGSPGHPGQPGPPGPPGAPGP | Collagen alpha-1(III) chain | Urine | 2648.1994 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10966 | AVGPPGFAGEKGPSGEAGTAGPPGTPGPQG | Collagen alpha-2(I) chain | Urine | 2650.2165 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10967 | ERGEAGIPGVPGAKGEDGKDGSPGEPGA | Collagen alpha-1(III) chain | Urine | 2655.2113 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10968 | NRGERGSEGSPGHPGQPGPPGPPGAPGP | Collagen alpha-1(III) chain | Urine | 2664.2119 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10969 | EAGRDGNPGNDGPPGRDGQPGHKGER | Collagen alpha-2(I) chain | Urine | 2675.1926 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10970 | NRGERGSEGSPGHPGQPGPPGPPGAPGP | Collagen alpha-1(III) chain | Urine | 2680.1757 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10971 | KDGEAGAQGPPGPAGPAGERGEQGPAGSPG | Collagen alpha-1(I) chain | Urine | 2688.2119 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10972 | NRGERGSEGSPGHPGQPGPPGPPGAPGP | Collagen alpha-1(III) chain | Urine | 2696.2304 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10974 | KNGETGPQGPPGPTGPGGDKGDTGPPGPQG | Collagen alpha-1(III) chain | Urine | 2727.2526 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10975 | EAGRDGNPGNDGPPGRDGQPGHKGERG | Collagen alpha-2(I) chain | Urine | 2732.2053 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10976 | NDGARGSDGQPGPPGPPGTAGFPGSPGAKG | Collagen alpha-1(III) chain | Urine | 2740.2117 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10977 | KNGETGPQGPPGPTGPGGDKGDTGPPGPQG | Collagen alpha-1(III) chain | Urine | 2743.2447 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10978 | ERGSPGPAGPKGSPGEAGRPGEAGLPGAKG | Collagen alpha-1(I) chain | Urine | 2762.3302 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10979 | KEGGKGPRGETGPAGRPGEVGPPGPPGPAG | Collagen alpha-1(I) chain | Urine | 2768.3665 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10981 | ERGSPGPAGPKGSPGEAGRPGEAGLPGAKG | Collagen alpha-1(I) chain | Urine | 2778.3258 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10982 | ERGEAGIPGVPGAKGEDGKDGSPGEPGANG | Collagen alpha-1(III) chain | Urine | 2810.2794 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10984 | ERGEAGIPGVPGAKGEDGKDGSPGEPGANG | Collagen alpha-1(III) chain | Urine | 2826.275 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10985 | PPGPPGKNGDDGEAGKPGRPGERGPPGPQ | Collagen alpha-1(I) chain | Urine | 2855.2918 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10986 | GRDGNPGNDGPPGRDGQPGHKGERGYPG | Collagen alpha-2(I) chain | Urine | 2865.2657 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10987 | GRDGNPGNDGPPGRDGQPGHKGERGYPG | Collagen alpha-2(I) chain | Urine | 2881.2582 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10988 | VNGAPGEAGRDGNPGNDGPPGRDGQPGHKG | Collagen alpha-2(I) chain | Urine | 2901.2748 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10989 | GPPGPPGKNGDDGEAGKPGRPGERGPPGPQ | Collagen alpha-1(I) chain | Urine | 2912.3455 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10991 | RGPPGPPGKNGDDGEAGKPGRPGERGPPGP | Collagen alpha-1(I) chain | Urine | 2924.4042 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10992 | VLSPADKTNVKAAWGKVGAHAGEYGAEAL | Hemoglobin subunit alpha | Urine | 2926.5099 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11001 | EAGRDGNPGNDGPPGRDGQPGHKGERGYPG | Collagen alpha-2(I) chain | Urine | 3065.3383 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11003 | VAHVDDMPNALSALSDLHAHKLRVDPVNF | Hemoglobin subunit alpha | Urine | 3197.6092 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11023 | VAHVDDMPNALSALSDLHAHKLRVDPVNFKL | Hemoglobin subunit alpha | Urine | 3438.8067 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11051 | NRIPESGGDNSVFDIFELTGAARKGSGR | Thrombospondin-1 | Serum | 2950.6 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Upregulated in patients vs normal with mean intensity 84.95 in control and 666.08 in cancer | 26993605 |
| CancerPDF_ID11055 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | ITIH4 | Serum | 3273 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Downregulated in ESCC patients vs control with mean intensity in cancer 221.86 and mean intensity in normal 764.46 | 26993605 |
| CancerPDF_ID11056 | SYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Serum | 3239.9 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Upregulated in ESCC patients vs control with mean intensity in cancer as 831.12 and mean intensity in control as 100.55 | 26993605 |
| CancerPDF_ID12676 | QGLLPVLESFKVSFLSALEEYTKKLNTQ | Apolipoprotein A-I | Serum | NA | LC-MS | Renal cell carcinaoma | Upregulated in cancer v/s Normal | 25168216 |
| CancerPDF_ID12681 | QPVLVGLFLSMYLITVLGNLLIILAVSC | Olfactory receptor | Serum | NA | LC-MS | Renal cell carcinaoma | Downregulated in cancer v/s Normal | 25168216 |
| CancerPDF_ID12727 | KMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Serum | 3005.608 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.73 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 2.39, Upregulated in BC vs healthy with 2.324 fold change" | 27058005 |
| CancerPDF_ID12728 | SSSYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha chain | Serum | 3206.443 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.44 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.05, Upregulated in BC vs healthy with 0.958 fold change" | 27058005 |
| CancerPDF_ID12729 | SSSYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha chain | Serum | 3277.592 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.43 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.11, Upregulated in BC vs healthy with 0.942 fold change" | 27058005 |
| CancerPDF_ID12737 | PGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 2724.46 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.22 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.72, Upregulated in BC vs healthy with 1.080 fold change" | 27058005 |
| CancerPDF_ID12738 | NVHSGSTFFKYYLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 3156.679 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.52 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.11, Upregulated in BC vs healthy with 1.158 fold change" | 27058005 |
| CancerPDF_ID12739 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 3272.752 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.42 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.89, Upregulated in BC vs healthy with 1.036 fold change" | 27058005 |
| CancerPDF_ID12740 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 3288.759 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.34 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.85, Upregulated in BC vs healthy with 1.126 fold change" | 27058005 |
| CancerPDF_ID12761 | SSSYSKQFTSSTSYNRGDSTFESKSYKM | "FGA, Isoform 2 of Fibrinogen alpha chain" | Serum | 3210 | MALDI-TOF | Cervical cancer | Downregulated in Cervical squamous cell carcinoma vs healthy | 26282206 |
| CancerPDF_ID12762 | SSSYSKQFTSSTSYNRGDSTFESKSYKMA | "FGA, Isoform 2 of Fibrinogen alpha chain" | Serum | 3265.1 | MALDI-TOF | Cervical cancer | Downregulated in Cervical squamous cell carcinoma vs healthy | 26282206 |
| CancerPDF_ID12763 | DAHKSEVAHRFKDLGEENFKALVLIAFAQ | "Albumin, Isoform CRA_f" | Serum | 3281.7 | MALDI-TOF | Cervical cancer | Downregulated in Cervical squamous cell carcinoma vs healthy | 26282206 |
| CancerPDF_ID12883 | HGFESGDFVSFSEVQGMVELNGNQPMEIK | Ubiquitin-like modifier activating enzyme 1 | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |