Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID959 | NA | NA | Serum | 797.46 | MALDI-TOF | Colorectal cancer | Downregulated in cancer vs normal | 23091368 |
| CancerPDF_ID960 | NA | NA | Serum | 824.78 | MALDI-TOF | Colorectal cancer | Downregulated in cancer vs normal | 23091368 |
| CancerPDF_ID965 | NA | NA | Serum | 849.66 | MALDI-TOF | Colorectal cancer | Downregulated in cancer vs normal | 23091368 |
| CancerPDF_ID967 | NA | NA | Serum | 741.43 | MALDI-TOF | Colorectal cancer | Downregulated and considered as candidate biomarker | 23091368 |
| CancerPDF_ID970 | NA | NA | Serum | 682.37 | MALDI-TOF | Colorectal cancer | Downregulated in cancer vs normal | 23091368 |
| CancerPDF_ID971 | NA | NA | Serum | 909.82 | MALDI-TOF | Colorectal cancer | Downregulated in cancer vs normal | 23091368 |
| CancerPDF_ID973 | NA | NA | Serum | 720.62 | MALDI-TOF | Colorectal cancer | Downregulated in cancer vs normal | 23091368 |
| CancerPDF_ID977 | NA | NA | Serum | 895.59 | MALDI-TOF | Colorectal cancer | Downregulated in cancer vs normal | 23091368 |
| CancerPDF_ID998 | NA | NA | Serum | 6635.24 | MALDI-TOF | Colorectal cancer | Downregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1004 | NA | NA | Serum | 1213.46 | MALDI-TOF | Colorectal cancer | Downregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1010 | NA | NA | Serum | 4248.84 | MALDI-TOF | Colorectal cancer | Downregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1012 | NA | NA | Serum | 3316.26 | MALDI-TOF | Colorectal cancer | Downregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1019 | LAEGGGVR | Fibrinopeptide A | Serum | 758.45 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.66, 0.95 and 0.65 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1021 | DFLAEGGGVR | Fibrinopeptide A | Serum | 1020.47 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.28, 0.28 and 0.47 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1022 | GDFLAEGGGVR | Fibrinopeptide A | Serum | 1077.53 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.54, 0.5 and 0.97 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1023 | EGDFLAEGGGVR | Fibrinopeptide A | Serum | 1206.57 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.5, 0.44 and 0.69 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1024 | GEGDFLAEGGGVR | Fibrinopeptide A | Serum | 1263.6 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.2, 0.24 and 0.23 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1025 | SGEGDFLAEGGGVR | Fibrinopeptide A | Serum | 1350.64 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.47, 0.46 and 0.35 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1026 | DSGEGDFLAEGGGVR | Fibrinopeptide A | Serum | 1465.65 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.66, 0.55 and 0.8 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1027 | ADSGEGDFLAEGGGVR | Fibrinopeptide A | Serum | 1536.68 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.58, 0 and 0.54 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1030 | SSSYSKQFTSSTSYNRGDSTFESKS | Fibrinogen alpha chain | Serum | 2768.3 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.77, 0.03 and 0.98 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1031 | SSSYSKQFTSSTSYNRGDSTFESKSY | Fibrinogen alpha chain | Serum | 2931.29 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in bladder cancer and upregulated in prostate cancer vs normal with Ratio of median intensity (patients/Controls) = 1.24, 0.13 and 0.97 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1032 | SSSYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha chain | Serum | 3190.4 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.52, 0 and 0.94 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1033 | SSSYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha chain | Serum | 3261.4 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.33, 0.08 and 0.74 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1044 | ITHRIHWESASLL | Complement C3f | Serum | 1562.84 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =0.79, 1.13 and 0.54 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1059 | HAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 842.4 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in Prostate cancer vs normal,Downregulated in Bladder cancer vs normal with Ratio of median intensity (patients/Controls) =1.49, 0.01 and 1.04 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1064 | GVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H9 | Serum | 2627.48 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =2.24, 0.26 and 1.07 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1168 | NA | NA | Serum | 7763.77 | MALDI-TOF | Lung cancer | Downregulated in cancer vs normal with average expression of peptide in cancer 2.86 and in normal 9.82 | 21082738 |
| CancerPDF_ID1169 | NA | NA | Serum | 8139.78 | MALDI-TOF | Lung cancer | Downregulated in cancer vs normal with average expression of peptide in cancer 0.59 and in normal 1.14 | 21082738 |
| CancerPDF_ID1170 | NA | NA | Serum | 7952.52 | MALDI-TOF | Lung cancer | Downregulated in cancer vs normal with average expression of peptide in cancer 0.42 and in normal 0.68 | 21082738 |
| CancerPDF_ID1171 | NA | NA | Serum | 3883.6 | MALDI-TOF | Lung cancer | Downregulated in cancer vs normal with average expression of peptide in cancer 2.78 and in normal 7.01 | 21082738 |
| CancerPDF_ID1174 | NA | NA | Serum | 7563.89 | MALDI-TOF | Lung cancer | Downregulated in cancer vs normal with average expression of peptide in cancer 0.35 and in normal 0.49 | 21082738 |
| CancerPDF_ID1178 | NA | NA | Serum | 6938.61 | MALDI-TOF | Lung cancer | Downregulated in cancer vs normal with average expression of peptide in cancer 0.55 and in normal 0.74 | 21082738 |
| CancerPDF_ID1181 | NA | NA | Serum | 4054.39 | MALDI-TOF | Lung cancer | Downregulated in cancer vs normal with average expression of peptide in cancer 4.8 and in normal 7.91 | 21082738 |
| CancerPDF_ID1182 | NA | NA | Serum | 2093.35 | MALDI-TOF | Lung cancer | Downregulated in cancer vs normal with average expression of peptide in cancer 1.56 and in normal 2.19 | 21082738 |
| CancerPDF_ID1183 | NA | NA | Serum | 7651.7 | MALDI-TOF | Lung cancer | Downregulated in cancer vs normal with average expression of peptide in cancer 0.4 and in normal 0.67 | 21082738 |
| CancerPDF_ID1184 | NA | NA | Serum | 6431.8 | MALDI-TOF | Lung cancer | Downregulated in cancer vs normal with average expression of peptide in cancer 2.31 and in normal 4.32 | 21082738 |
| CancerPDF_ID1185 | NA | NA | Serum | 6389.3 | MALDI-TOF | Lung cancer | Downregulated in cancer vs normal with average expression of peptide in cancer 0.61 and in normal 0.98 | 21082738 |
| CancerPDF_ID1191 | NA | NA | Serum | 1945.57 | MALDI-TOF | Lung cancer | Downregulated in cancer vs normal with average expression of peptide in cancer 1.74 and in normal 2.14 | 21082738 |
| CancerPDF_ID1192 | NA | NA | Serum | 7007.68 | MALDI-TOF | Lung cancer | Downregulated in cancer vs normal with average expression of peptide in cancer 0.59 and in normal 0.72 | 21082738 |
| CancerPDF_ID1193 | NA | NA | Serum | 4210.3 | MALDI-TOF | Lung cancer | Downregulated in cancer vs normal with average expression of peptide in cancer 38.81 and in normal 51.58 | 21082738 |
| CancerPDF_ID1197 | NA | NA | Serum | 4073.09 | MALDI-TOF | Lung cancer | Downregulated in cancer vs normal with average expression of peptide in cancer 3.34 and in normal 4.39 | 21082738 |
| CancerPDF_ID1199 | NA | NA | Serum | 4963.95 | MALDI-TOF | Lung cancer | Downregulated in cancer vs normal with average expression of peptide in cancer 2.62 and in normal 4.19 | 21082738 |
| CancerPDF_ID1202 | NA | NA | Serum | 9285.97 | MALDI-TOF | Lung cancer | Downregulated in cancer vs normal with average expression of peptide in cancer 9.67 and in normal 11.91 | 21082738 |
| CancerPDF_ID3337 | NA | NA | Serum | 1546.43 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3338 | NA | NA | Serum | 7763.24 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3340 | NA | NA | Serum | 2093.19 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3341 | NA | NA | Serum | 7563.83 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3343 | NA | NA | Serum | 7920.5 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3344 | NA | NA | Serum | 8139.21 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3348 | NA | NA | Serum | 3883.45 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3350 | NA | NA | Serum | 3952.19 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3357 | NA | NA | Serum | 1012.61 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3358 | NA | NA | Serum | 1519.98 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3359 | NA | NA | Serum | 1945.53 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3363 | NA | NA | Serum | 3934.92 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3364 | NA | NA | Serum | 4153.16 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3366 | NA | NA | Serum | 6387.9 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3367 | NA | NA | Serum | 6529.26 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3368 | NA | NA | Serum | 6937.21 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3372 | NA | NA | Serum | 7007.25 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3373 | NA | NA | Serum | 4194.12 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3374 | NA | NA | Serum | 7651.87 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3380 | NA | NA | Serum | 1207.13 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3381 | NA | NA | Serum | 4169.93 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3382 | NA | NA | Serum | 8762.73 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3387 | NA | NA | Serum | 8812.29 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3388 | NA | NA | Serum | 1945.53 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3395 | NA | NA | Serum | 4054.17 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3398 | NA | NA | Serum | 6431.4 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3399 | NA | NA | Serum | 6629.53 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3400 | NA | NA | Serum | 8686.87 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3409 | VLNLGPITR | Uromodulin | Urine | NA | CE-MS-TOF | Bladder cancer | Downregulated in cancer vs normal | 21591268 |
| CancerPDF_ID3410 | SGDSDDDEPPPLPRL | Membrane associated progesterone receptor component 1 | Urine | NA | CE-MS-TOF | Bladder cancer | Downregulated in cancer vs normal | 21591268 |
| CancerPDF_ID3411 | PpGEAGKpGEQGVPGDLG | Collagen alpha-1(I) chain | Urine | NA | CE-MS-TOF | Bladder cancer | Downregulated in cancer vs normal | 21591268 |
| CancerPDF_ID4004 | VLPIPQQVVPYPQRAVPVQALL | Beta-casein | Human milk | NA | MALDI-TOF | Normal and pre-term Milk individual | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4005 | LLLNQELLLNPTHQIYPV | Beta-casein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4006 | VLPIPQQVVPYPQRAVPVQALLLNQ | Beta-casein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4007 | VLPIPQQVVPYPQRAVPVQALLL | Beta-casein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4008 | HLPLPLLQPLMQQVPQPIPQT | Beta-casein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4009 | LKSPTIPFFDPQIPKLTDLEN | Beta-casein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4010 | VEPIPYGFLPQNILPLA | Beta-casein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4011 | LGSAMQNTQNLLQMPY | Alpha-2-macroglobin | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4012 | LWSVPQPKVLPIPQQV | Beta-casein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4013 | DLENLH | Beta-casein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4014 | VEPIPYGFLPQNILPLAQP | Beta-casein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4015 | DPDAPLQPVTPLQL | C4A(Complement C4-A) variant protein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4016 | LLLNQELLLNPTHQIYPVTQPLAP | Beta-casein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4017 | FVEPIPYGFLPQNILP | Beta-casein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4018 | VEPIPYGFLPQNILP | Beta-casein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4019 | IPFFDPQIPKLTDLEN | Beta-casein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4020 | WGRLTWRKMCRKLLDMTFSS | vWF-cleaving protease | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4021 | TIPFFDPQIPKLTDLEN | Beta-casein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4022 | DLENLHLPL | Beta-casein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4023 | LTDLENLHLPLPLLQP | Beta-casein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4024 | DDPDAPLQPVTPLQLFEGRRN | C4A(Complement C4-A) variant protein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4025 | GRVMPVLKSPTIPFFDPQIPK | Beta-casein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4026 | LLQPLMQQVPQPIPQTLALPPQP | Beta-casein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4027 | DLENLHLPLPLLQPLM | Beta-casein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4028 | YPFVEPIPYGFL | Beta-casein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4029 | ASQLMGENRTMTIHNGMFFST | Fibrinogen beta chain | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4030 | LVNERWVLTAA | Kallikrein-7 | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4031 | LWSVPQPKVLPIP | Beta-casein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4032 | DSGSSEEKQLYNKYPDAVAT | Secreted phosphoprotein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4033 | AVVLPVPQPEIMEVPKAKDTVYT | Beta-casein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4034 | WRKMCRKLLDMTFSSKTNTLVVR | vWF-cleaving protease | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4035 | QPLMQQVPQPIPQTLALPPQP | Beta-casein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4036 | LAQPAVVLPVPQPEIMEVPK | Beta-casein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4037 | ATSSLCSVTNTSMMTSE | Ascites sialoglycoprotein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4038 | LQPLMQQVPQPIP | Beta-casein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4039 | SIQLPTTVRDIMNRW | Membrane alanine aminopeptidase variant | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4040 | AVPVQALLLNQ | Beta-casein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4041 | APVHNPISV | Beta-casein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4042 | MKFISTSLLLMLLVSSLS | B cell-attracting chemokine 1 | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4043 | LLNPTHQIYPVT | Beta-casein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID4044 | EDLIDEDDIPVRSFFP | C4A(Complement C4-A) variant protein | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID8618 | TPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS | Apolipoprotein C-I precursor | Serum | 6625.91 | MALDI-TOF | Breast cancer | Downregulated in cancer as compare to normal control with fold change of 1.5 | 26705257 |
| CancerPDF_ID8619 | FLGDRDFNQFSSGEKNIFLASFVHEYSR | Fetoprotein (AFP) precursor | Serum | 3315.21 | MALDI-TOF | Breast cancer | Downregulated in cancer as compare to normal control with fold change of 1.6 | 26705257 |
| CancerPDF_ID8620 | ARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ | Apolipoprotein A-I precursor | Serum | 6428.21 | MALDI-TOF | Breast cancer | Downregulated in cancer as compare to normal control with fold change of 1.7 | 26705257 |
| CancerPDF_ID8621 | VELGTQPATQ | Apolipoprotein A-II precursor | Serum | 1041.25 | MALDI-TOF | Breast cancer | Downregulated in cancer as compare to normal control with fold change of 1.8 | 26705257 |
| CancerPDF_ID8632 | NA | NA | Urine | 1097.49 | MALDI-TOF | Cervical cancer | Downregulated in cancer vs normal | 24416269 |
| CancerPDF_ID8635 | GQDGRPGPPGPPG | Alpha-1 type I collagen | Urine | 1236.56 | MALDI-TOF | Cervical cancer | Downregulated in cancer vs normal | 24416269 |
| CancerPDF_ID8639 | NA | NA | Urine | 1587.97 | MALDI-TOF | Cervical cancer | Downregulated in cancer vs normal | 24416269 |
| CancerPDF_ID8640 | NA | NA | Plasma | 1746.78 | MALDI-TOF | Cervical cancer | Downregulated in cancer vs normal | 24416269 |
| CancerPDF_ID8643 | KHNLGHGHKHERDQGHGHQ | "Kininogen L,high MW" | Plasma | 2209.06 | MALDI-TOF | Cervical cancer | Downregulated in cancer vs normal | 24416269 |
| CancerPDF_ID8644 | NA | NA | Plasma | 2228.05 | MALDI-TOF | Cervical cancer | Downregulated in cancer vs normal | 24416269 |
| CancerPDF_ID8649 | MKWVTFISLLFLFSSAYSRGVFRR | Albumin peptide (N terminal fragment of protein albumin) | Cerbrospinal fluid | NA | MALDI-TOF | Glioblastoma (Malignant brain tumor) | Downregulated in cancer as compare to normal control | 19674866 |
| CancerPDF_ID11036 | NA | NA | Serum | 1866.63 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11037 | NA | NA | Serum | 3317 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11038 | NA | NA | Serum | 6433.36 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11039 | NA | NA | Serum | 1780.1 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11040 | NA | NA | Serum | 1061.34 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11048 | NA | NA | Serum | 1981.69 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11049 | NA | NA | Serum | 1077.14 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11050 | NA | NA | Serum | 1547 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11053 | MGVVSLGSPSGEVSHPRKT | Alpha2-HS glycoprotein | Serum | 1925.5 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Downregulated in patients vs normal with mean intensity in cancer 149.51 and mean intensity in normal as 590.32 | 26993605 |
| CancerPDF_ID11055 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | ITIH4 | Serum | 3273 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Downregulated in ESCC patients vs control with mean intensity in cancer 221.86 and mean intensity in normal 764.46 | 26993605 |
| CancerPDF_ID11057 | LTKKFSRHHGPTITAKL | AMBP | Serum | 1935.9 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | "Downregulated in ESCC patients vs control with mean intensity in cancer 1018.23 and mean intensity in normal 2,456.36in normal" | 26993605 |
| CancerPDF_ID11070 | NA | NA | Serum | 3264.9 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Downregulated in ESCC patients vs control with mean intensity in cancer and mean intensity in normal | 26993605 |
| CancerPDF_ID11080 | NA | UROM_HUMAN | Urine | 1912.106 | MALDI-TOF | Clear cell renal carcinoma | Downregulated with increse in tumor mass | 26482227 |
| CancerPDF_ID11081 | NA | MMP23_HUMAN | Urine | 1934.197 | MALDI-TOF | Clear cell renal carcinoma | Downregulated with increse in tumor mass | 26482227 |
| CancerPDF_ID11082 | NA | MYH1_HUMAN | Urine | 1934.197 | MALDI-TOF | Clear cell renal carcinoma | Downregulated with increse in tumor mass | 26482227 |
| CancerPDF_ID11091 | NA | G3P_HUMAN | Urine | 3723.84 | MALDI-TOF | Clear cell renal carcinoma | Downregulated with increse in tumor mass | 26482227 |
| CancerPDF_ID11095 | NA | PTGDS_HUMAN | Urine | 1525 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in pT1b compared to pT1a patients | 26482227 |
| CancerPDF_ID11096 | NA | A1AG1_HUMAN | Urine | 1755.8 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in pT1b compared to pT1a patients | 26482227 |
| CancerPDF_ID11097 | NA | A1AG2_HUMAN | Urine | 1755.8 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in pT1b compared to pT1a patients | 26482227 |
| CancerPDF_ID11103 | NA | NA | Urine | 1219.1 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in pT1b compared to pT1a patients | 26482227 |
| CancerPDF_ID11104 | NA | NA | Urine | 2282.1 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in pT1b compared to pT1a patients | 26482227 |
| CancerPDF_ID11113 | NA | NA | Urine | 3723.8 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in grade vs normal | 26482227 |
| CancerPDF_ID11115 | NA | NA | Urine | 4355.1 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in grade vs normal | 26482227 |
| CancerPDF_ID11116 | NA | NA | Urine | 4751.5 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in grade vs normal | 26482227 |
| CancerPDF_ID11117 | NA | NA | Urine | 5004.4 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in grade vs normal | 26482227 |
| CancerPDF_ID11118 | NA | NA | Urine | 5027.8 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in grade vs normal | 26482227 |
| CancerPDF_ID11119 | NA | NA | Urine | 5043.6 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in grade vs normal | 26482227 |
| CancerPDF_ID11122 | NA | NA | Urine | 1894.3 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID11123 | NA | NA | Urine | 1912.1 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID11124 | NA | NA | Urine | 1934.2 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID11126 | NA | NA | Urine | 2961.1 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID11127 | NA | NA | Urine | 4026.9 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID11128 | NA | NA | Urine | 4638.5 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID11129 | NA | NA | Urine | 4751.5 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID11132 | NA | NA | Urine | 5578.2 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID11133 | NA | NA | Urine | 6261.4 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID11134 | NA | NA | Urine | 6305.2 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID11135 | NA | NA | Urine | 8181.9 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID12675 | IYQLNSKLV | Cubilin | Serum | NA | LC-MS | Renal cell carcinaoma | Downregulated in cancer v/s Normal | 25168216 |
| CancerPDF_ID12681 | QPVLVGLFLSMYLITVLGNLLIILAVSC | Olfactory receptor | Serum | NA | LC-MS | Renal cell carcinaoma | Downregulated in cancer v/s Normal | 25168216 |
| CancerPDF_ID12688 | AGISMRSGDSPQD | NA | Serum | NA | LC-MS | Renal cell carcinaoma | Downregulated in cancer v/s Normal | 25168216 |
| CancerPDF_ID12689 | NA | NA | Serum | NA | LC-MS | Renal cell carcinaoma | Downregulated in cancer v/s Normal | 25168216 |
| CancerPDF_ID12690 | TRHTFGRI | NA | Serum | NA | LC-MS | Renal cell carcinaoma | Downregulated in cancer v/s Normal | 25168216 |
| CancerPDF_ID12759 | NA | NA | Serum | 2934.4 | MALDI-TOF | Cervical cancer | Downregulated in Cervical squamous cell carcinoma vs healthy | 26282206 |
| CancerPDF_ID12760 | NA | NA | Serum | 3194.1 | MALDI-TOF | Cervical cancer | Downregulated in Cervical squamous cell carcinoma vs healthy | 26282206 |
| CancerPDF_ID12761 | SSSYSKQFTSSTSYNRGDSTFESKSYKM | "FGA, Isoform 2 of Fibrinogen alpha chain" | Serum | 3210 | MALDI-TOF | Cervical cancer | Downregulated in Cervical squamous cell carcinoma vs healthy | 26282206 |
| CancerPDF_ID12762 | SSSYSKQFTSSTSYNRGDSTFESKSYKMA | "FGA, Isoform 2 of Fibrinogen alpha chain" | Serum | 3265.1 | MALDI-TOF | Cervical cancer | Downregulated in Cervical squamous cell carcinoma vs healthy | 26282206 |
| CancerPDF_ID12763 | DAHKSEVAHRFKDLGEENFKALVLIAFAQ | "Albumin, Isoform CRA_f" | Serum | 3281.7 | MALDI-TOF | Cervical cancer | Downregulated in Cervical squamous cell carcinoma vs healthy | 26282206 |
| CancerPDF_ID12769 | NA | NA | Serum | 7643.01 | MALDI-TOF | Hepatocellular carcinoma | Downregulated in cancer vs Healthy | 25910294 |
| CancerPDF_ID12770 | NA | NA | Serum | 7927.69 | MALDI-TOF | Hepatocellular carcinoma | Downregulated in cancer vs Healthy | 25910294 |
| CancerPDF_ID12771 | NA | NA | Serum | 7833.44 | MALDI-TOF | Hepatocellular carcinoma | Downregulated in cancer vs Healthy | 25910294 |
| CancerPDF_ID12772 | NA | NA | Serum | 4397.32 | MALDI-TOF | Hepatocellular carcinoma | Downregulated in cancer vs Healthy | 25910294 |
| CancerPDF_ID12773 | NA | NA | Serum | 7771.17 | MALDI-TOF | Hepatocellular carcinoma | Downregulated in cancer vs Healthy | 25910294 |
| CancerPDF_ID12774 | NA | NA | Serum | 5027.39 | MALDI-TOF | Hepatocellular carcinoma | Downregulated in cancer vs Healthy | 25910294 |
| CancerPDF_ID12775 | NA | NA | Serum | 7896.09 | MALDI-TOF | Hepatocellular carcinoma | Downregulated in cancer vs Healthy | 25910294 |
| CancerPDF_ID12776 | NA | NA | Serum | 8147.79 | MALDI-TOF | Hepatocellular carcinoma | Downregulated in cancer vs Healthy | 25910294 |
| CancerPDF_ID12777 | NA | NA | Serum | 9359.98 | MALDI-TOF | Hepatocellular carcinoma | Downregulated in cancer vs Healthy | 25910294 |
| CancerPDF_ID12778 | NA | NA | Serum | 4965.18 | MALDI-TOF | Hepatocellular carcinoma | Downregulated in cancer vs Healthy | 25910294 |
| CancerPDF_ID12779 | NA | NA | Serum | 6636.05 | MALDI-TOF | Hepatocellular carcinoma | Downregulated in cancer vs Healthy | 25910294 |
| CancerPDF_ID12781 | NA | NA | Serum | 4272.16 | MALDI-TOF | Hepatocellular carcinoma | Downregulated in cancer vs Healthy | 25910294 |
| CancerPDF_ID12782 | NA | NA | Serum | 9524.77 | MALDI-TOF | Hepatocellular carcinoma | Downregulated in cancer vs Healthy | 25910294 |
| CancerPDF_ID12783 | NA | NA | Serum | 2510.81 | MALDI-TOF | Hepatocellular carcinoma | Downregulated in cancer vs Healthy | 25910294 |
| CancerPDF_ID12844 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12846 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12848 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12849 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12850 | GDSTFESKSYKMADEAGSEADHEGTHSTKRGHAKSRPV | Isoform 1 of Fibrinogen alpha chain precursor | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12851 | EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES | Platelet factor 4 | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12852 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12853 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12854 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12857 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12858 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12859 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12860 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12861 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12862 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12863 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12864 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12865 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12867 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12868 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12869 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12870 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12871 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12872 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12873 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12874 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12876 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12878 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12879 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12880 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12881 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12883 | HGFESGDFVSFSEVQGMVELNGNQPMEIK | Ubiquitin-like modifier activating enzyme 1 | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12886 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12887 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12889 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12895 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Downregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12896 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Downregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12900 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Downregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12901 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Downregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12904 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Downregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12905 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Downregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12906 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Downregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12907 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Downregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12908 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Downregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12927 | NA | NA | Serum | "3,951.98" | MALDI-TOF | Gastric cancer | Downregulated in Gastric cancer vs healthy | 21739109 |
| CancerPDF_ID14045 | NA | NA | Serum | 1088.69 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14046 | NA | NA | Serum | 1096.78 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14049 | NA | NA | Serum | 1143.89 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14050 | NA | NA | Serum | 1212.67 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14051 | NA | NA | Serum | 1227.25 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14052 | NA | NA | Serum | 1241.7 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14053 | NA | NA | Serum | 1248.98 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14054 | NA | NA | Serum | 1258.66 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14055 | NA | NA | Serum | 1273.17 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14056 | NA | NA | Serum | 1281.53 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14057 | NA | NA | Serum | 1287.41 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14058 | NA | NA | Serum | 1295.3 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14062 | NA | NA | Serum | 1327.7 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14064 | NA | NA | Serum | 1354.98 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14065 | NA | NA | Serum | 1370.79 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14066 | NA | NA | Serum | 1392.08 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14067 | NA | NA | Serum | 1399.05 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14068 | NA | NA | Serum | 1415.72 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14069 | NA | NA | Serum | 1439.17 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14070 | NA | NA | Serum | 1455 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14071 | NA | NA | Serum | 1460.96 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14073 | NA | NA | Serum | 1485.7 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14075 | NA | NA | Serum | 1498.44 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14076 | NA | NA | Serum | 1506.5 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14078 | NA | NA | Serum | 1519.73 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14079 | NA | NA | Serum | 1529.44 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14080 | NA | NA | Serum | 1538.68 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14081 | NA | NA | Serum | 1550.47 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14082 | NA | NA | Serum | 1556.56 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14083 | NA | NA | Serum | 1559.64 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14084 | NA | NA | Serum | 1565.35 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14085 | NA | NA | Serum | 1572.06 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14086 | NA | NA | Serum | 1582.27 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14087 | NA | NA | Serum | 1589.31 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14088 | NA | NA | Serum | 1597.1 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14089 | NA | NA | Serum | 1608.21 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14090 | NA | NA | Serum | 1615.01 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14091 | NA | NA | Serum | 1620.2 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14092 | NA | NA | Serum | 1625.99 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14093 | NA | NA | Serum | 1636.15 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14094 | NA | NA | Serum | 1647.41 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14095 | NA | NA | Serum | 1658.02 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14096 | NA | NA | Serum | 1678.44 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14097 | NA | NA | Serum | 1689.97 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14098 | NA | NA | Serum | 1699.85 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14121 | NA | NA | Serum | 1985.26 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14123 | NA | NA | Serum | 1993.57 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14125 | NA | NA | Serum | 2024.1 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14135 | NA | NA | Serum | 2122.72 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14138 | NA | NA | Serum | 2158.64 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14147 | NA | NA | Serum | 2268.04 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14154 | NA | NA | Serum | 2354.08 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14157 | NA | NA | Serum | 2394.68 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14162 | NA | NA | Serum | 2481.33 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14163 | NA | NA | Serum | 2512.32 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14164 | NA | NA | Serum | 2527.07 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14174 | NA | NA | Serum | 2673.78 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14175 | NA | NA | Serum | 2683.85 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14176 | NA | NA | Serum | 2695.37 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14177 | NA | NA | Serum | 2703.22 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14178 | NA | NA | Serum | 2712.72 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14182 | NA | NA | Serum | 2782.47 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14184 | NA | NA | Serum | 2810.41 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14186 | NA | NA | Serum | 2875.06 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14187 | NA | NA | Serum | 2898.83 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14189 | NA | NA | Serum | 2923.07 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14190 | NA | NA | Serum | 2944.7 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14191 | NA | NA | Serum | 2955.85 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14192 | NA | NA | Serum | 2969.57 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14193 | NA | NA | Serum | 2982.09 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14194 | NA | NA | Serum | 2990.56 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14195 | NA | NA | Serum | 3000.11 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14200 | NA | NA | Serum | 3202.88 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14201 | NA | NA | Serum | 3219.25 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14202 | NA | NA | Serum | 3225.57 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14203 | NA | NA | Serum | 3241.58 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14204 | NA | NA | Serum | 3243.83 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14205 | NA | NA | Serum | 3251.37 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14206 | NA | NA | Serum | 3259.8 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14207 | NA | NA | Serum | 3263.78 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14208 | NA | NA | Serum | 3273.51 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14210 | NA | NA | Serum | 3295.4 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14212 | NA | NA | Serum | 3310.7 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14213 | NA | NA | Serum | 3311.31 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14218 | NA | NA | Serum | 3458.93 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14219 | NA | NA | Serum | 3478.14 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14227 | NA | NA | Serum | 3941.59 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14232 | NA | NA | Serum | 3986.36 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14235 | NA | NA | Serum | 4060.17 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14238 | NA | NA | Serum | 4097.29 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14239 | NA | NA | Serum | 4109.9 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14241 | NA | NA | Serum | 4176.36 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14242 | NA | NA | Serum | 4200.84 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14243 | NA | NA | Serum | 4208.25 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14244 | NA | NA | Serum | 4210.42 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14245 | NA | NA | Serum | 4215.74 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14246 | NA | NA | Serum | 4226.84 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14248 | NA | NA | Serum | 4248.09 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14249 | NA | NA | Serum | 4272.68 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14261 | NA | NA | Serum | 4488.26 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14265 | NA | NA | Serum | 4968.92 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14275 | NA | NA | Serum | 5320.45 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14276 | NA | NA | Serum | 5327.39 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14277 | NA | NA | Serum | 5339.21 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14279 | NA | NA | Serum | 5352.7 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14281 | NA | NA | Serum | 5858.57 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14282 | NA | NA | Serum | 5862.99 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14283 | NA | NA | Serum | 5869.26 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14284 | NA | NA | Serum | 5875.44 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14285 | NA | NA | Serum | 5880.54 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14286 | NA | NA | Serum | 5881.57 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14287 | NA | NA | Serum | 5888.05 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14288 | NA | NA | Serum | 5893.17 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14289 | NA | NA | Serum | 5895.44 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14290 | NA | NA | Serum | 5903.45 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14291 | NA | NA | Serum | 5916.57 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14292 | NA | NA | Serum | 5922.78 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14293 | NA | NA | Serum | 5924.43 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14294 | NA | NA | Serum | 5925.4 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14295 | NA | NA | Serum | 5931.69 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14296 | NA | NA | Serum | 5943.94 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |