Browse result page of CancerPDF Database

Please click on CancerPDF_ID for detailed information about peptide.

CancerPDF_IDPeptide seqProtein NameFluidMass/ZProfiling TechniqueCancer Type Expression RegulationPUBMED ID
CancerPDF_ID4057 AALGCLVKDYFPEPVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID4245 ALGCLVKDYFPEPVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID4522 CLVKDYFPEPVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID4537 CVVVDVSHEDPEVKFPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID5099 GCLVKDYFPEPVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID5142 GGTAALGCLVKDYFPEPVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID5307 GTAALGCLVKDYFPEPVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID5392 HTFPAVLQSSGLYSLSSVVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID5531 ISRTPEVTCVVVDVSHEDPEVKFPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID5590 KFNWYVDGVEVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID5598 KGPSVFPLAPSSKSTSGGTAALGCLVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID5811 LGCLVKDYFPEPVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID5955 LMISRTPEVTCVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID5961 LMISRTPEVTCVVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID5967 LMISRTPEVTCVVVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID6362 NWYVDGVEVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID6368 NWYVDGVEVHPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID6374 NWYVDGVEVHNAPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID6738 SAASTKGPSVFPLAPSSKSTSGGTAALGCLVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID6842 SGGTAALGCLVKDYFPEPVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID6846 SGGTAALGCLVKDYFPEPVTVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID6890 SGVHTFPAVLQSSGLYSPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID6896 SGVHTFPAVLQSSGLYSLPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID6902 SGVHTFPAVLQSSGLYSLSPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID6908 SGVHTFPAVLQSSGLYSLSSPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID6914 SGVHTFPAVLQSSGLYSLSSVVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7075 SRTPEVTCVVVDVSHEDPEVKFPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7143 STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7153 STSGGTAALGCLVKDYFPEPVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7201 SVVTVPSSSLGTQTYICNVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7220 SWNSGALTSGVHTFPAPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7227 SWNSGALTSGVHTFPAVLPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7233 SWNSGALTSGVHTFPAVLQPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7239 SWNSGALTSGVHTFPAVLQSPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7245 SWNSGALTSGVHTFPAVLQSSPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7252 SWNSGALTSGVHTFPAVLQSSGLYPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7258 SWNSGALTSGVHTFPAVLQSSGLYSPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7264 SWNSGALTSGVHTFPAVLQSSGLYSLPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7270 SWNSGALTSGVHTFPAVLQSSGLYSLSPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7276 SWNSGALTSGVHTFPAVLQSSGLYSLSSPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7282 SWNSGALTSGVHTFPAVLQSSGLYSLSSVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7288 SWNSGALTSGVHTFPAVLQSSGLYSLSSVVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7588 TVLHQDWLNGKEYPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7595 TVPSSSLGTQTYIPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7600 TVPSSSLGTQTYICNVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7609 TVSWNSGALTSGVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7615 TVSWNSGALTSGVHTFPAPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7622 TVSWNSGALTSGVHTFPAVLPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7628 TVSWNSGALTSGVHTFPAVLQPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7634 TVSWNSGALTSGVHTFPAVLQSPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7641 TVSWNSGALTSGVHTFPAVLQSSGLYPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7647 TVSWNSGALTSGVHTFPAVLQSSGLYSPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7653 TVSWNSGALTSGVHTFPAVLQSSGLYSLPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7659 TVSWNSGALTSGVHTFPAVLQSSGLYSLSSPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7665 TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7671 TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7772 VDVSHEDPEVKFPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7917 VLQSSGLYSLPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7923 VLQSSGLYSLSSPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7929 VLQSSGLYSLSSVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7935 VLQSSGLYSLSSVVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7940 VLQSSGLYSLSSVVTVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID7946 VLQSSGLYSLSSVVTVPSSSLGTQTYICNVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID8013 VSWNSGALTSGVHTFPAPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID8032 VTVPSSSLGTQTYIPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID8037 VTVPSSSLGTQTYICNVPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID8066 VVDVSHEDPEVKFPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608
CancerPDF_ID8164 WNSGALTSGVHTFPAPutative uncharacterized protein DKFZp686G11190UrineNANano-LC-MSOvarian cancer Uniquely present in case of urine of ovarian cancer patients 24982608