Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID3407 | QVLPVGVLGPPGQQAPPPYPGPHPAGPPVIQQPTTPMFVAPPPK | Protein polybromo-1 | Plasma | NA | Linear ion-trap mass spectrometer (LTQ) coupled with a Surveyor HPLC-MS | Breast cancer | Differentially expressed between normal and patients | 24565027 |
| CancerPDF_ID11085 | NA | KPB1_HUMAN | Urine | 2192.065 | MALDI-TOF | Clear cell renal carcinoma | "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" | 26482227 |
| CancerPDF_ID11099 | NA | KPB1_HUMAN | Urine | 2192.1 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in pT1b compared to pT1a patients | 26482227 |
| CancerPDF_ID12245 | SPTPGSPGSPG | DNA-directed RNA polymerase II subunit RPB1 | Serum | NA | LC-MS | Melanoma | "Present in 2 cancer samples out of 8 cancer samples. ,Present in 0 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID12465 | TPQSNRPVM | DNA-directed RNA polymerase II subunit RPB1 | Serum | 1028.5073 | LC-MS | Melanoma | "Present in 1 cancer samples out of 8 cancer samples. ,Present in 1 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID12674 | TPQSNRPVM | DNA-directed RNA polymerase II subunit RPB1 | Serum | NA | LC-MS | Melanoma | "Present in 1 cancer samples out of 8 cancer samples. ,Present in 1 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID13879 | SPAVAAPAY | Heat shock protein beta-1 | Plasma | 846.436 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |
| CancerPDF_ID13983 | SSFGRGFFK | Liprin-beta-1 | Plasma | 1032.527 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |