Browse result page of CancerPDF Database

Please click on CancerPDF_ID for detailed information about peptide.

CancerPDF_ID	Peptide seq	Protein Name	Fluid	Mass/Z	Profiling Technique	Cancer Type	Expression Regulation	PUBMED ID
CancerPDF_ID3403	SLWLQSQPHFCCFWLTVTFPPPLQTHRELAQSSHAQR	NT-3 growth factor receptor	Plasma	NA	Linear ion-trap mass spectrometer (LTQ) coupled with a Surveyor HPLC-MS	Breast cancer	Differentially expressed between normal and patients	24565027
CancerPDF_ID3405	LSWNHVARALTLTQSLVSSVTSGK	NT-3 growth factor receptor	Plasma	NA	Linear ion-trap mass spectrometer (LTQ) coupled with a Surveyor HPLC-MS	Breast cancer	Differentially expressed between normal and patients	24565027