Browse result page of CancerPDF Database

Please click on CancerPDF_ID for detailed information about peptide.

CancerPDF_ID	Peptide seq	Protein Name	Fluid	Mass/Z	Profiling Technique	Cancer Type	Expression Regulation	PUBMED ID
CancerPDF_ID6501	QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKW	Neutrophil gelatinase-associated lipocalin	Urine	NA	Nano-LC-MS	Ovarian cancer	Uniquely present in case of urine of ovarian cancer patients	24982608
CancerPDF_ID6502	QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWY	Neutrophil gelatinase-associated lipocalin	Urine	NA	Nano-LC-MS	Ovarian cancer	Uniquely present in case of urine of ovarian cancer patients	24982608