Browse result page of CancerPDF Database

Please click on CancerPDF_ID for detailed information about peptide.

CancerPDF_ID	Peptide seq	Protein Name	Fluid	Mass/Z	Profiling Technique	Cancer Type	Expression Regulation	PUBMED ID
CancerPDF_ID161	RPPGFSPF	Bradykinin	Serum	904.4726	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS	19728888
CancerPDF_ID162	NDNEEGFFSAR	Fibrinopeptide B	Serum	1129.4849	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS	19728888
CancerPDF_ID163	NA	NA	Serum	1183.5995	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID164	NA	NA	Serum	1201.5663	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID165	GEGDFLAEGGGVR	Fibrinopeptide A	Serum	1263.5958	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS	19728888
CancerPDF_ID166	NA	NA	Serum	1288.6006	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID167	NA	NA	Serum	1347.5297	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID168	SGEGDFLAEGGGVR	Fibrinopeptide A	Serum	1350.6275	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID169	NA	NA	Serum	1389.6433	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID170	NA	NA	Serum	1402.671	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID171	NA	NA	Serum	1418.539	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID172	NA	NA	Serum	1432.644	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID173	NA	NA	Serum	1440.5407	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID174	NA	NA	Serum	1445.5828	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID175	NA	NA	Serum	1447.6855	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID176	NA	NA	Serum	1450.4893	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID177	NA	NA	Serum	1456.5093	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID178	NA	NA	Serum	1458.4946	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID179	NA	NA	Serum	1460.6257	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID180	NA	NA	Serum	1477.6539	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID181	NA	NA	Serum	1479.6646	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID182	NA	NA	Serum	1487.6226	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID183	NA	NA	Serum	1491.6634	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID184	NA	NA	Serum	1501.748	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID185	NA	NA	Serum	1503.5994	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID186	NA	NA	Serum	1507.6643	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID187	ADSGEGDFLAEGGGVR	fibrinopeptide A;	Serum	1536.6906	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS	19728888
CancerPDF_ID188	EGVNDNEEGFFSA	Glu-1-fibrinopeptide B;	Serum	1552.669	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS	19728888
CancerPDF_ID189	NA	NA	Serum	1561.7288	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID190	NA	NA	Serum	1569.6823	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID191	NA	NA	Serum	1573.7005	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID192	ADSGEGDFLAEGGGVR	phospho-fibrinopeptide A	Serum	1616.6366	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS and Peptide signature for differentiation between healthy and NSCLC patients	19728888
CancerPDF_ID193	NA	NA	Serum	1630.6679	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID194	NA	NA	Serum	1670.5947	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID195	KITHRIHWESASLL	Complement C3f	Serum	1690.9254	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS	19728888
CancerPDF_ID196	SKITHRIHWESASLL	Complement C3f	Serum	1777.966	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS	19728888
CancerPDF_ID197	SSKITHRIHWESASLL	Complement C3f	Serum	1865.0022	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS	19728888
CancerPDF_ID198	NA	NA	Serum	2494.1536	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID199	HKSEVAHRFKDLGEENFKALVL	Serum albumin	Serum	2567.3659	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS	19728888
CancerPDF_ID200	AVPPNNSNAAEDDLPTVELQGVVPR	Coagulation factor XIIIA	Serum	2602.3048	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS	19728888
CancerPDF_ID201	NA	NA	Serum	2743.4663	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID202	NA	NA	Serum	2747.4349	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID203	NA	NA	Serum	2789.0914	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	"Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment"	19728888
CancerPDF_ID204	NVHSGSTFFKYYLQGAKIPKPEASFSPR	inter-alpha-trypsin inhibitor heavy chain H4	Serum	3156.6207	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS	19728888
CancerPDF_ID205	SKITHRIHWESASLL	Complement C3 f	Serum	1777.966	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID206	NA	NA	Serum	1877.9926	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID207	NA	NA	Serum	1545.616	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID208	KITHRIHWESASLL	Complement C3 f	Serum	1690.9254	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID209	SSKITHRIHWESASLL	Complement C3 f	Serum	1865.0022	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID210	NA	NA	Serum	1039.6249	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID211	NA	NA	Serum	1361.7417	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID212	NA	NA	Serum	880.4127	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID213	NA	NA	Serum	1041.6349	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID214	NA	NA	Serum	1955.9949	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID215	NA	NA	Serum	1015.6267	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID216	NA	NA	Serum	1087.5722	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID217	NA	NA	Serum	1063.6231	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID218	NA	NA	Serum	1092.5826	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID219	NA	NA	Serum	2318.2202	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID220	NA	NA	Serum	2536.2991	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID221	NA	NA	Serum	2105.4972	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID222	NA	NA	Serum	1396.5679	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID223	NA	NA	Serum	2112.022	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID224	NA	NA	Serum	987.5905	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID225	ADSGEGDFLAEGGGVR	Phospho-fibrinopetide A	Serum	1616.6366	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID226	SPMYSIITPNILRLESEETM	Complement C3 beta/f	Serum	2324.1475	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Signature peptide that can Differentiate between NSCLC patients and healthy volunteers	19728888
CancerPDF_ID227	NA	NA	Serum	2104.998	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID228	NA	NA	Serum	2153.0655	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID229	NA	NA	Serum	1450.4893	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID230	SPMYSIITPNILRLESEET	Complement C3 beta/f	Serum	2193.1036	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Signature peptide that can Differentiate between NSCLC patients and healthy volunteers	19728888
CancerPDF_ID231	NA	NA	Serum	898.4169	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID232	NA	NA	Serum	3427.8221	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID233	NA	NA	Serum	2163.9817	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID234	NA	NA	Serum	1670.5947	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID235	NA	NA	Serum	2099.1139	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID236	NA	NA	Serum	1456.5093	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID237	NA	NA	Serum	1418.539	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID238	NA	NA	Serum	1630.6679	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID239	NA	NA	Serum	2228.0362	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID240	NA	NA	Serum	2209.0934	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID241	VLSPADKTNVKAAWGKVGAHAGEYGAEALERM	Hemoglobin alpha	Serum	3326.6863	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Signature peptide that can Differentiate between NSCLC patients and healthy volunteers	19728888
CancerPDF_ID242	NA	NA	Serum	1434.5136	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID243	VLSPADKTNVKAAWGKVGAHAGEYGAEALERMF	Hemoglobin alpha	Serum	3473.7545	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Signature peptide that can Differentiate between NSCLC patients and healthy volunteers	19728888
CancerPDF_ID244	NA	NA	Serum	1432.644	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID245	NA	NA	Serum	1292.4157	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID246	NA	NA	Serum	1440.5407	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID247	NA	NA	Serum	2246.1744	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID248	NA	NA	Serum	2789.0914	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID249	NVHSGSTFFKYYLQGAKIPKPEASFSPR	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	3156.6207	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID250	NA	NA	Serum	1276.456	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID251	NA	NA	Serum	1458.4946	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID252	NA	NA	Serum	2489.3052	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID253	NA	NA	Serum	2318.2202	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID254	NA	NA	Serum	2209.0934	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID255	NA	NA	Serum	2215.2849	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID256	NA	NA	Serum	2376.2096	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID257	NA	NA	Serum	1545.616	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients vs healthy volunteers	19728888
CancerPDF_ID258	NA	NA	Serum	2215.2849	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients with a partial response versus patients with stable or progressive disease	19728888
CancerPDF_ID259	NA	NA	Serum	2009.0039	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients with a partial response versus patients with stable or progressive disease	19728888
CancerPDF_ID260	NA	NA	Serum	2318.2202	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients with a partial response versus patients with stable or progressive disease	19728888
CancerPDF_ID261	NA	NA	Serum	2378.1982	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients with a partial response versus patients with stable or progressive disease	19728888
CancerPDF_ID262	NA	NA	Serum	900.4258	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients with a partial response versus patients with stable or progressive disease	19728888
CancerPDF_ID263	NA	Fibrinopeptide A	Serum	1616.6366	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients with a partial response versus patients with stable or progressive disease	19728888
CancerPDF_ID264	NA	NA	Serum	1596.189	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients with a partial response versus patients with stable or progressive disease	19728888
CancerPDF_ID265	NA	NA	Serum	872.4325	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients with a partial response versus patients with stable or progressive disease	19728888
CancerPDF_ID266	NA	NA	Serum	3215.1939	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients with a partial response versus patients with stable or progressive disease	19728888
CancerPDF_ID267	NA	NA	Serum	1631.2111	MALDI-TOF	"Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy"	Differentially expressed between NSCLC patients with a partial response versus patients with stable or progressive disease	19728888
CancerPDF_ID1168	NA	NA	Serum	7763.77	MALDI-TOF	Lung cancer	Downregulated in cancer vs normal with average expression of peptide in cancer 2.86 and in normal 9.82	21082738
CancerPDF_ID1169	NA	NA	Serum	8139.78	MALDI-TOF	Lung cancer	Downregulated in cancer vs normal with average expression of peptide in cancer 0.59 and in normal 1.14	21082738
CancerPDF_ID1170	NA	NA	Serum	7952.52	MALDI-TOF	Lung cancer	Downregulated in cancer vs normal with average expression of peptide in cancer 0.42 and in normal 0.68	21082738
CancerPDF_ID1171	NA	NA	Serum	3883.6	MALDI-TOF	Lung cancer	Downregulated in cancer vs normal with average expression of peptide in cancer 2.78 and in normal 7.01	21082738
CancerPDF_ID1172	NA	NA	Serum	3279.25	MALDI-TOF	Lung cancer	Upregulated in cancer vs normal with average expression of peptide in cancer 4.22 and in normal 1.87	21082738
CancerPDF_ID1173	NA	NA	Serum	2881.24	MALDI-TOF	Lung cancer	Upregulated in cancer vs normal with average expression of peptide in cancer 3.01 and in normal 1.47	21082738
CancerPDF_ID1174	NA	NA	Serum	7563.89	MALDI-TOF	Lung cancer	Downregulated in cancer vs normal with average expression of peptide in cancer 0.35 and in normal 0.49	21082738
CancerPDF_ID1175	NA	NA	Serum	3208.59	MALDI-TOF	Lung cancer	Upregulated in cancer vs normal with average expression of peptide in cancer 2.57 and in normal 1.56	21082738
CancerPDF_ID1176	NA	NA	Serum	1741.48	MALDI-TOF	Lung cancer	Upregulated in cancer vs normal with average expression of peptide in cancer 4.13 and in normal 2.11	21082738
CancerPDF_ID1177	NA	NA	Serum	6047.99	MALDI-TOF	Lung cancer	Upregulated in cancer vs normal with average expression of peptide in cancer 1.3 and in normal 0.86	21082738
CancerPDF_ID1178	NA	NA	Serum	6938.61	MALDI-TOF	Lung cancer	Downregulated in cancer vs normal with average expression of peptide in cancer 0.55 and in normal 0.74	21082738
CancerPDF_ID1179	NA	NA	Serum	5248.05	MALDI-TOF	Lung cancer	Upregulated in cancer vs normal with average expression of peptide in cancer 1.38 and in normal 1.02	21082738
CancerPDF_ID1180	NA	NA	Serum	5079.93	MALDI-TOF	Lung cancer	Upregulated in cancer vs normal with average expression of peptide in cancer 1.4 and in normal 0.89	21082738
CancerPDF_ID1181	NA	NA	Serum	4054.39	MALDI-TOF	Lung cancer	Downregulated in cancer vs normal with average expression of peptide in cancer 4.8 and in normal 7.91	21082738
CancerPDF_ID1182	NA	NA	Serum	2093.35	MALDI-TOF	Lung cancer	Downregulated in cancer vs normal with average expression of peptide in cancer 1.56 and in normal 2.19	21082738
CancerPDF_ID1183	NA	NA	Serum	7651.7	MALDI-TOF	Lung cancer	Downregulated in cancer vs normal with average expression of peptide in cancer 0.4 and in normal 0.67	21082738
CancerPDF_ID1184	NA	NA	Serum	6431.8	MALDI-TOF	Lung cancer	Downregulated in cancer vs normal with average expression of peptide in cancer 2.31 and in normal 4.32	21082738
CancerPDF_ID1185	NA	NA	Serum	6389.3	MALDI-TOF	Lung cancer	Downregulated in cancer vs normal with average expression of peptide in cancer 0.61 and in normal 0.98	21082738
CancerPDF_ID1186	NA	NA	Serum	5293.03	MALDI-TOF	Lung cancer	Upregulated in cancer vs normal with average expression of peptide in cancer 1.52 and in normal 0.91	21082738
CancerPDF_ID1187	NA	NA	Serum	4530.17	MALDI-TOF	Lung cancer	Upregulated in cancer vs normal with average expression of peptide in cancer 1.23 and in normal 0.69	21082738
CancerPDF_ID1188	NA	NA	Serum	1887.19	MALDI-TOF	Lung cancer	Upregulated in cancer vs normal with average expression of peptide in cancer 2.6 and in normal 2.15	21082738
CancerPDF_ID1189	NA	NA	Serum	1082.52	MALDI-TOF	Lung cancer	Upregulated in cancer vs normal with average expression of peptide in cancer 4.48 and in normal 1.68	21082738
CancerPDF_ID1190	NA	NA	Serum	2770.03	MALDI-TOF	Lung cancer	Upregulated in cancer vs normal with average expression of peptide in cancer 6.6 and in normal 4.07	21082738
CancerPDF_ID1191	NA	NA	Serum	1945.57	MALDI-TOF	Lung cancer	Downregulated in cancer vs normal with average expression of peptide in cancer 1.74 and in normal 2.14	21082738
CancerPDF_ID1192	NA	NA	Serum	7007.68	MALDI-TOF	Lung cancer	Downregulated in cancer vs normal with average expression of peptide in cancer 0.59 and in normal 0.72	21082738
CancerPDF_ID1193	NA	NA	Serum	4210.3	MALDI-TOF	Lung cancer	Downregulated in cancer vs normal with average expression of peptide in cancer 38.81 and in normal 51.58	21082738
CancerPDF_ID1194	NA	NA	Serum	1331.23	MALDI-TOF	Lung cancer	Upregulated in cancer vs normal with average expression of peptide in cancer 2.86 and in normal 2.14	21082738
CancerPDF_ID1195	NA	NA	Serum	1350.83	MALDI-TOF	Lung cancer	Upregulated in cancer vs normal with average expression of peptide in cancer 2.73 and in normal 1.75	21082738
CancerPDF_ID1196	NA	NA	Serum	1066.34	MALDI-TOF	Lung cancer	Upregulated in cancer vs normal with average expression of peptide in cancer 4.62 and in normal 2.44	21082738
CancerPDF_ID1197	NA	NA	Serum	4073.09	MALDI-TOF	Lung cancer	Downregulated in cancer vs normal with average expression of peptide in cancer 3.34 and in normal 4.39	21082738
CancerPDF_ID1198	NA	NA	Serum	2545.94	MALDI-TOF	Lung cancer	Upregulated in cancer vs normal with average expression of peptide in cancer 1.96 and in normal 1.37	21082738
CancerPDF_ID1199	NA	NA	Serum	4963.95	MALDI-TOF	Lung cancer	Downregulated in cancer vs normal with average expression of peptide in cancer 2.62 and in normal 4.19	21082738
CancerPDF_ID1200	NA	NA	Serum	2046.59	MALDI-TOF	Lung cancer	Upregulated in cancer vs normal with average expression of peptide in cancer 3.67 and in normal 2.79	21082738
CancerPDF_ID1201	NA	NA	Serum	1866.51	MALDI-TOF	Lung cancer	Upregulated in cancer vs normal with average expression of peptide in cancer 6.58 and in normal 3.02	21082738
CancerPDF_ID1202	NA	NA	Serum	9285.97	MALDI-TOF	Lung cancer	Downregulated in cancer vs normal with average expression of peptide in cancer 9.67 and in normal 11.91	21082738
CancerPDF_ID1203	NA	NA	Serum	1450.73	MALDI-TOF	Lung cancer	Upregulated in cancer vs normal with average expression of peptide in cancer 5.64 and in normal 2.81	21082738
CancerPDF_ID1204	NA	NA	Serum	3061.3	MALDI-TOF	Lung cancer	Upregulated in cancer vs normal with average expression of peptide in cancer 3.12 and in normal 1.18	21082738
CancerPDF_ID1205	NA	NA	Serum	4712.02	MALDI-TOF	Lung cancer	Upregulated in cancer vs normal with average expression of peptide in cancer 1.03 and in normal 0.68	21082738
CancerPDF_ID3337	NA	NA	Serum	1546.43	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Downregulated in cancer vs normal	22628229
CancerPDF_ID3338	NA	NA	Serum	7763.24	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Downregulated in cancer vs normal	22628229
CancerPDF_ID3339	NA	NA	Serum	2883.76	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3340	NA	NA	Serum	2093.19	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Downregulated in cancer vs normal	22628229
CancerPDF_ID3341	NA	NA	Serum	7563.83	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Downregulated in cancer vs normal	22628229
CancerPDF_ID3342	NA	NA	Serum	6047.64	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3343	NA	NA	Serum	7920.5	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Downregulated in cancer vs normal	22628229
CancerPDF_ID3344	NA	NA	Serum	8139.21	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Downregulated in cancer vs normal	22628229
CancerPDF_ID3345	NA	NA	Serum	2932.99	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3346	NA	NA	Serum	1887.15	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3347	NA	NA	Serum	1897.93	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3348	NA	NA	Serum	3883.45	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Downregulated in cancer vs normal	22628229
CancerPDF_ID3349	NA	NA	Serum	1741.38	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3350	NA	NA	Serum	3952.19	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Downregulated in cancer vs normal	22628229
CancerPDF_ID3351	NA	NA	Serum	7468.37	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3352	NA	NA	Serum	5292.77	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3353	NA	NA	Serum	5079.68	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3354	NA	NA	Serum	1350.83	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3355	NA	NA	Serum	2554.64	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3356	NA	NA	Serum	4529.7	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3357	NA	NA	Serum	1012.61	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Downregulated in cancer vs normal	22628229
CancerPDF_ID3358	NA	NA	Serum	1519.98	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Downregulated in cancer vs normal	22628229
CancerPDF_ID3359	NA	NA	Serum	1945.53	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Downregulated in cancer vs normal	22628229
CancerPDF_ID3360	NA	NA	Serum	2669.09	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3361	NA	NA	Serum	2878.89	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3362	NA	NA	Serum	3208.49	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3363	NA	NA	Serum	3934.92	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Downregulated in cancer vs normal	22628229
CancerPDF_ID3364	NA	NA	Serum	4153.16	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Downregulated in cancer vs normal	22628229
CancerPDF_ID3365	NA	NA	Serum	5264.02	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3366	NA	NA	Serum	6387.9	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Downregulated in cancer vs normal	22628229
CancerPDF_ID3367	NA	NA	Serum	6529.26	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Downregulated in cancer vs normal	22628229
CancerPDF_ID3368	NA	NA	Serum	6937.21	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Downregulated in cancer vs normal	22628229
CancerPDF_ID3369	NA	NA	Serum	2953.31	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3370	NA	NA	Serum	1450.55	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3371	NA	NA	Serum	1779.31	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3372	NA	NA	Serum	7007.25	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Downregulated in cancer vs normal	22628229
CancerPDF_ID3373	NA	NA	Serum	4194.12	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Downregulated in cancer vs normal	22628229
CancerPDF_ID3374	NA	NA	Serum	7651.87	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Downregulated in cancer vs normal	22628229
CancerPDF_ID3375	NA	NA	Serum	8562.86	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3376	NA	NA	Serum	1082.44	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3377	NA	NA	Serum	2769.86	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3378	NA	NA	Serum	5753.12	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3379	NA	NA	Serum	4281.54	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3380	NA	NA	Serum	1207.13	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Downregulated in cancer vs normal	22628229
CancerPDF_ID3381	NA	NA	Serum	4169.93	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Downregulated in cancer vs normal	22628229
CancerPDF_ID3382	NA	NA	Serum	8762.73	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Downregulated in cancer vs normal	22628229
CancerPDF_ID3383	NA	NA	Serum	1563.43	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3384	NA	NA	Serum	1331.12	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3385	NA	NA	Serum	2545.83	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3386	NA	NA	Serum	1866.42	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3387	NA	NA	Serum	8812.29	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Downregulated in cancer vs normal	22628229
CancerPDF_ID3388	NA	NA	Serum	1945.53	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Downregulated in cancer vs normal	22628229
CancerPDF_ID3389	NA	NA	Serum	2281.08	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3390	NA	NA	Serum	1563.11	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3391	NA	NA	Serum	2281.08	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3392	NA	NA	Serum	2682.65	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3393	NA	NA	Serum	2900.91	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3394	NA	NA	Serum	3279.09	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3395	NA	NA	Serum	4054.17	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Downregulated in cancer vs normal	22628229
CancerPDF_ID3396	NA	NA	Serum	5247.81	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3397	NA	NA	Serum	5336.3	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Upregulated in cancer vs normal	22628229
CancerPDF_ID3398	NA	NA	Serum	6431.4	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Downregulated in cancer vs normal	22628229
CancerPDF_ID3399	NA	NA	Serum	6629.53	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Downregulated in cancer vs normal	22628229
CancerPDF_ID3400	NA	NA	Serum	8686.87	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Downregulated in cancer vs normal	22628229
CancerPDF_ID8413	NA	NA	Serum	1933.52	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 42.86% ; In Rectal cancer : 19.44% ; Breast cancer: 0%; In normal healthy individuals : 97.2%	23667664
CancerPDF_ID8414	NA	NA	Serum	2210.34	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	"Frequency of peptide Breast cancer: 77%, In lung cancer :78.57% ; In Rectal cancer : 86.11% ; In normal healthy individuals : 97.2%"	23667664
CancerPDF_ID8415	NA	NA	Serum	2933.03	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 81.43% ; In Rectal cancer : 97.22% ; Breast cancer: 89%; In normal healthy individuals : 97%	23667664
CancerPDF_ID8416	NA	NA	Serum	7740.77	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 85.71% ; In Rectal cancer : 97.22% ; Breast cancer: 98%; In normal healthy individuals : 95.2%	23667664
CancerPDF_ID8417	NA	NA	Serum	4617.02	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 88.57% ; In Rectal cancer : 94.44% ; Breast cancer: 93%; In normal healthy individuals : 94.2%	23667664
CancerPDF_ID8418	NA	NA	Serum	4144.83	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 85.71% ; In Rectal cancer : 94.44% ; Breast cancer: 93%; In normal healthy individuals : 92.4%	23667664
CancerPDF_ID8419	NA	NA	Serum	6412.9	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 92.86% ; In Rectal cancer : 97.22% ; Breast cancer: 97%; In normal healthy individuals : 91%	23667664
CancerPDF_ID8420	NA	NA	Serum	3891.63	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 45.71% ; In Rectal cancer : 33.33% ; Breast cancer: 62%; In normal healthy individuals : 88.2%	23667664
CancerPDF_ID8421	NA	NA	Serum	4455.33	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 81.43% ; In Rectal cancer : 88.89% ; Breast cancer: 67%; In normal healthy individuals : 86.2%	23667664
CancerPDF_ID8422	NA	NA	Serum	4269.96	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 72.86% ; In Rectal cancer : 69.44% ; Breast cancer: 78%; In normal healthy individuals : 82.4%	23667664
CancerPDF_ID8423	NA	NA	Serum	8901.56	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 97.14% ; In Rectal cancer : 97.22% ; Breast cancer: 100%; In normal healthy individuals : 81.2%	23667664
CancerPDF_ID8424	SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAKSRPV	Fibrinogen alpha	Serum	5905.24	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 78.57% ; In Rectal cancer : 86.11% ; Breast cancer: 72%; In normal healthy individuals : 80.6%	23667664
CancerPDF_ID8425	NA	NA	Serum	3152.18	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 52.85% ; In Rectal cancer : 61.11% ; Breast cancer: 43%; In normal healthy individuals : 79.8%	23667664
CancerPDF_ID8426	NA	NA	Serum	3212.45	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 62.86% ; In Rectal cancer : 86.11% ; Breast cancer: 72%; In normal healthy individuals : 79.2%	23667664
CancerPDF_ID8427	NA	NA	Serum	2068.72	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 5.71% ; In Rectal cancer : 22.22% ; Breast cancer: 1%; In normal healthy individuals : 78.80%	23667664
CancerPDF_ID8428	NA	NA	Serum	3362.65	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 81.43% ; In Rectal cancer : 91.67% ; Breast cancer: 72%; In normal healthy individuals : 77.4%	23667664
CancerPDF_ID8429	NA	NA	Serum	2266.53	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 58.57% ; In Rectal cancer : 66.67% ; Breast cancer: 70%; In normal healthy individuals : 76.6%	23667664
CancerPDF_ID8430	NA	NA	Serum	8097	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 91.43% ; In Rectal cancer : 86.11% ; Breast cancer: 97%; In normal healthy individuals : 72.2%	23667664
CancerPDF_ID8431	NA	NA	Serum	3434.65	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 84.29% ; In Rectal cancer : 86.11% ; Breast cancer: 77%; In normal healthy individuals :72%	23667664
CancerPDF_ID8432	NA	NA	Serum	3948.85	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 41.43% ; In Rectal cancer : 41.67% ; Breast cancer: 48%; In normal healthy individuals : 71%	23667664
CancerPDF_ID8433	NA	NA	Serum	4130.82	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 42.86% ; In Rectal cancer : 63.89% ; Breast cancer: 49%; In normal healthy individuals : 70.6%	23667664
CancerPDF_ID8434	NA	NA	Serum	2769.85	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 38.57% ; In Rectal cancer : 58.33% ; Breast cancer: 50%; In normal healthy individuals : 70.20%	23667664
CancerPDF_ID8435	NA	NA	Serum	2545.69	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 70% ; In Rectal cancer : 69.44% ; Breast cancer: 59%; In normal healthy individuals : 68%	23667664
CancerPDF_ID8436	NA	NA	Serum	4279.75	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 44.29% ; In Rectal cancer : 33.33% ; Breast cancer: 57%; In normal healthy individuals : 68%	23667664
CancerPDF_ID8437	NA	NA	Serum	1998.39	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In normal healthy individuals : 66.2%	23667664
CancerPDF_ID8438	NA	NA	Serum	3302.32	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 92.86% ; In Rectal cancer : 97.22% ; Breast cancer: 95%; In normal healthy individuals : 65%	23667664
CancerPDF_ID8439	NA	NA	Serum	4626.49	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 30% ; In Rectal cancer : 55.56% ; Breast cancer: 29%; In normal healthy individuals : 64.60%	23667664
CancerPDF_ID8440	NA	NA	Serum	9223.32	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 81.43% ; In Rectal cancer : 75% ; Breast cancer: 70%; In normal healthy individuals : 60.60%	23667664
CancerPDF_ID8441	NA	NA	Serum	2660.78	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 60% ; In Rectal cancer : 88.89% ; Breast cancer: 80%; In normal healthy individuals : 58.20%	23667664
CancerPDF_ID8442	NA	NA	Serum	13780.5	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 52.86% ; In Rectal cancer : 50% ; Breast cancer: 60%; In normal healthy individuals : 58.2%	23667664
CancerPDF_ID8443	NA	NA	Serum	3810.31	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer :35.71% ; In Rectal cancer : 50% ; Breast cancer: 32%; In normal healthy individuals : 57.6%	23667664
CancerPDF_ID8444	NA	NA	Serum	6626.75	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 98.57% ; In Rectal cancer : 97.22% ; Breast cancer: 98%; In normal healthy individuals : 55%	23667664
CancerPDF_ID8445	NA	NA	Serum	4160.55	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 34.29% ; In Rectal cancer : 16.67% ; Breast cancer: 37%; In normal healthy individuals :53.2%	23667664
CancerPDF_ID8446	NA	NA	Serum	6936.01	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 2.86% ; In Rectal cancer : 61.11% ; Breast cancer: 10%; In normal healthy individuals : 52%	23667664
CancerPDF_ID8447	NA	NA	Serum	2012.39	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 75.71% ; In Rectal cancer : 72.22% ; Breast cancer: 87%; In normal healthy individuals :49.4%	23667664
CancerPDF_ID8448	NA	NA	Serum	2597.36	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 11.43% ; In Rectal cancer : 22.22% ; Breast cancer: 59%; In normal healthy individuals : 48.8%	23667664
CancerPDF_ID8449	NA	NA	Serum	3184.7	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 7.14% ; In Rectal cancer : 50% ; Breast cancer: 30%; In normal healthy individuals : 48.4%	23667664
CancerPDF_ID8450	NA	NA	Serum	3872.19	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 42.86% ; In Rectal cancer : 75% ; Breast cancer: 45%; In normal healthy individuals : 48.2%	23667664
CancerPDF_ID8451	NA	NA	Serum	2082.73	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 5.71% ; In Rectal cancer : 19.44% ; Breast cancer: 67%; In normal healthy individuals : 47.2%	23667664
CancerPDF_ID8452	NA	NA	Serum	4786.97	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 51.43% ; In Rectal cancer : 77.78% ; Breast cancer: 58%; In normal healthy individuals : 45.20%	23667664
CancerPDF_ID8453	NA	NA	Serum	6526.74	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide in normal healthy : 45.2%	23667664
CancerPDF_ID8454	NA	NA	Serum	3254.85	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 24.29% ; In Rectal cancer : 44.44% ; Breast cancer: 21%; In normal healthy individuals : 41.8%	23667664
CancerPDF_ID8455	NA	NA	Serum	3316.32	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 92.86% ; In Rectal cancer : 97.22% ; Breast cancer: 95%; In normal healthy individuals : 40.6%	23667664
CancerPDF_ID8456	NA	NA	Serum	2863.06	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 78.57% ; In Rectal cancer : 83.33% ; Breast cancer: 80%; In normal healthy individuals : 39%	23667664
CancerPDF_ID8457	NA	NA	Serum	4207.72	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 25.71% ; In Rectal cancer : 38.89% ; Breast cancer: 26%; In normal healthy individuals : 37.8%	23667664
CancerPDF_ID8458	NA	NA	Serum	4175.84	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 24.29% ; In Rectal cancer : 27.78% ; Breast cancer: 41%; In normal healthy individuals : 37.6%	23667664
CancerPDF_ID8459	NA	NA	Serum	2944.24	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer :44.29% ; In Rectal cancer : 55.56% ; Breast cancer: 37%; In normal healthy individuals : 34.6%	23667664
CancerPDF_ID8460	NA	NA	Serum	3479.93	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 52.86% ; In Rectal cancer : 58.33% ; Breast cancer: 44%; In normal healthy individuals :34.2%	23667664
CancerPDF_ID8461	NA	NA	Serum	1856.94	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide in normal healthy : 32.80%	23667664
CancerPDF_ID8462	NA	NA	Serum	3226.75	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 1.43% ; In Rectal cancer : 2.78% ; Breast cancer: 3%; In normal healthy individuals : 32.6%	23667664
CancerPDF_ID8463	NA	NA	Serum	4342.03	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 40% ; In Rectal cancer : 50% ; Breast cancer: 32%; In normal healthy individuals : 28.8%	23667664
CancerPDF_ID8464	NA	NA	Serum	4121.95	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 14.29% ; In Rectal cancer : 16.67% ; Breast cancer: 15%; In normal healthy individuals : 28.8%	23667664
CancerPDF_ID8465	NA	NA	Serum	4193.63	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 8.57% ; In Rectal cancer : 8.33% ; Breast cancer: 16%; In normal healthy individuals : 28.8%	23667664
CancerPDF_ID8466	NA	NA	Serum	4529.82	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 4.29% ; In Rectal cancer : 41.67% ; Breast cancer: 28%; In normal healthy individuals : 26.2%	23667664
CancerPDF_ID8467	NA	NA	Serum	3241.49	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 88.57% ; In Rectal cancer : 86.11% ; Breast cancer: 83%; In normal healthy individuals : 25.6%	23667664
CancerPDF_ID8468	NA	NA	Serum	2124.16	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 10% ; In Rectal cancer : 11.11% ; Breast cancer: 8%; In normal healthy individuals : 25.6%	23667664
CancerPDF_ID8469	NA	NA	Serum	4237.35	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 0% ; In Rectal cancer : 19.44% ; Breast cancer: 14%; In normal healthy individuals : 25.6%	23667664
CancerPDF_ID8470	NA	NA	Serum	1463.76	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 40% ; In Rectal cancer : 58.33% ; Breast cancer: 26%; In normal healthy individuals :25.20%	23667664
CancerPDF_ID8471	NA	NA	Serum	3274.73	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 21.43% ; In Rectal cancer : 16.67% ; Breast cancer: 23%; In normal healthy individuals : 25%	23667664
CancerPDF_ID8472	NA	NA	Serum	3962.94	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 2.86% ; In Rectal cancer : 8.33% ; Breast cancer:3%; In normal healthy individuals : 24%	23667664
CancerPDF_ID8473	NA	NA	Serum	6836.01	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 57.14% ; In Rectal cancer : 0% ; Breast cancer: 71%; In normal healthy individuals : 23.6%	23667664
CancerPDF_ID8474	NA	NA	Serum	1779.05	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 7.14% ; In Rectal cancer : 27.78% ; Breast cancer: 11%; In normal healthy individuals : 23%	23667664
CancerPDF_ID8475	NA	NA	Serum	5319.96	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide in normal healthy : 23%	23667664
CancerPDF_ID8476	NA	NA	Serum	1947.61	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide in normal healthy : 21.20%	23667664
CancerPDF_ID8477	NA	NA	Serum	2379.64	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide In lung cancer : 14.20% ; In Rectal cancer : 19.44% ; Breast cancer: 4%; In normal healthy individuals : 20.6%	23667664
CancerPDF_ID8478	NA	NA	Serum	2075.72	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	"Frequency of peptide in lung cancer : 97.2% , In normal healthy individuals : 0%"	23667664
CancerPDF_ID8479	NA	NA	Serum	4069	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	"Frequency of peptide in lung cancer : 65.7% , In normal healthy individuals : 5.6%"	23667664
CancerPDF_ID8480	NA	NA	Serum	2652	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	"Frequency of peptide in lung cancer : 65.7% , In normal healthy individuals : 2.8%"	23667664
CancerPDF_ID8481	NA	NA	Serum	1787.97	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	"Frequency of peptide in lung cancer : 55.7% , In normal healthy individuals : 0.6%"	23667664
CancerPDF_ID8482	NA	NA	Serum	1945.03	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	"Frequency of peptide Breast cancer:99%, In lung cancer : 48.57% ; In Rectal cancer : 75% ; In normal healthy individuals : 0.4%"	23667664
CancerPDF_ID8483	NA	NA	Serum	2673.8	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide in lung cancer : 41.42% ; In breast cancer :42%; In normal healthy individuals : 6%	23667664
CancerPDF_ID8484	NA	NA	Serum	2991.23	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide Breast cancer: 29%; In lung cancer : 38.57% ; In Rectal cancer: 38.89%; In normal healthy individuals : 1.8%	23667664
CancerPDF_ID8485	NA	NA	Serum	1349.53	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide in lung cancer : 30% ; In Rectal cancer:58.33%; In normal healthy individuals : 8%	23667664
CancerPDF_ID8486	NA	NA	Serum	5000.21	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	Frequency of peptide in lung cancer : 30% ; In breast cancer: 37%; In normal healthy individuals : 7%	23667664
CancerPDF_ID8487	NA	NA	Serum	2976.33	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	"Frequency of peptide in lungcancer : 28.57% , In normal healthy individuals : 5.4%"	23667664
CancerPDF_ID8488	NA	NA	Serum	5282.44	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	"Frequency of peptide in rectal cancer : 66.67% , In normal healthy individuals : 1.2%"	23667664
CancerPDF_ID8489	NA	NA	Serum	4057.96	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	"Frequency of peptide in rectal cancer : 58.33% , In normal healthy individuals : 15.6%"	23667664
CancerPDF_ID8490	NA	NA	Serum	1207.29	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	"Frequency of peptide in rectal cancer : 52.787% , In normal healthy individuals : 10.6%"	23667664
CancerPDF_ID8491	NA	NA	Serum	4952.82	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	"Frequency of peptide in rectal cancer :50% , In normal healthy individuals : 7.2%"	23667664
CancerPDF_ID8492	NA	NA	Serum	2233.27	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	"Frequency of peptide in rectal cancer : 44.44% , In normal healthy individuals : 3.2%"	23667664
CancerPDF_ID8493	NA	NA	Serum	7458.63	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	"Frequency of peptide in rectal cancer : 41.67% , In normal healthy individuals : 5.2%"	23667664
CancerPDF_ID8494	NA	NA	Serum	2312.22	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	"Frequency of peptide in rectal cancer : 36.11% , In normal healthy individuals : 10%"	23667664
CancerPDF_ID8495	NA	NA	Serum	4468.34	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	"Frequency of peptide in breast cancer : 95% , In normal healthy individuals : 2.6%"	23667664
CancerPDF_ID8496	NA	NA	Serum	4057.96	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	"Frequency of peptide in breast cancer : 68% , In normal healthy individuals :1 5.6%"	23667664
CancerPDF_ID8497	NA	NA	Serum	5291.71	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	"Frequency of peptide in breast cancer : 64% , In normal healthy individuals : 0.4%"	23667664
CancerPDF_ID8498	NA	NA	Serum	1787.97	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	"Frequency of peptide in breast cancer :60% , In normal healthy individuals : 2%"	23667664
CancerPDF_ID8499	NA	NA	Serum	2726.07	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	"Frequency of peptide in breat cancer : 39% , In normal healthy individuals :6.60%"	23667664
CancerPDF_ID8500	NA	NA	Serum	2452.69	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	"Frequency of peptide in breast cancer : 28% , In normal healthy individuals : 1.2%"	23667664
CancerPDF_ID8501	ADSGEGDFLAEGGGVR	Fibrinogen alpha	Serum	1535.69	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8502	DSGEGDFLAEGGGVR	Fibrinogen alpha	Serum	1464.65	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8503	SGEGDFLAEGGGVR	Fibrinogen alpha	Serum	1349.62	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8504	GEGDFLAEGGGVR	Fibrinogen alpha	Serum	1262.59	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8505	EGDFLAEGGGVR	Fibrinogen alpha	Serum	1205.57	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8506	GDFLAEGGGVR	Fibrinogen alpha	Serum	1076.53	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8507	DFLAEGGGVR	Fibrinogen alpha	Serum	1019.5	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8508	DSGEGDFLAEGGGV	Fibrinogen alpha	Serum	1308.55	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8509	SGEGDFLAEGGGV	Fibrinogen alpha	Serum	1193.52	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8510	GDFLAEGGGV	Fibrinogen alpha	Serum	920.42	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8511	DFLAEGGGV	Fibrinogen alpha	Serum	863.4	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8512	FLAEGGGV	Fibrinogen alpha	Serum	748.38	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8513	FLAEGGG	Fibrinogen alpha	Serum	649.31	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8514	DFLAEGG	Fibrinogen alpha	Serum	707.31	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8515	NRGDSTFESKSY	Fibrinogen alpha	Serum	1389.62	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8516	SSSYSKQFTSSTSYNRGDSTFES	Fibrinogen alpha	Serum	2552.09	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8517	SSSYSKQFTSSTSYNRGDSTFESKS	Fibrinogen alpha	Serum	2767.22	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8518	SSSYSKQFTSSTSYNRGDSTFESKSY	Fibrinogen alpha	Serum	2930.28	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8519	SSSYSKQFTSSTSYNRGDSTFESKSYKM	Fibrinogen alpha	Serum	3189.42	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8520	SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHGTHSTK	Fibrinogen alpha	Serum	4783.09	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8521	SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHGTHSTKRG	Fibrinogen alpha	Serum	4996.21	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8522	SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHA	Fibrinogen alpha	Serum	5333.35	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8523	SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAKSRPV	Fibrinogen alpha	Serum	5900.7	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8524	GDSTFESKSYKMADEAGSEADHEGTHSTKRGHA	Fibrinogen alpha	Serum	3522.53	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8525	SYKMADEAGSEADHEGTHSTKRGHAKSRPV	Fibrinogen alpha	Serum	3238.52	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8526	SYKMADEAGSEADHEGTHSTKRGHA	Fibrinogen alpha	Serum	2671.17	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8527	SYKMADEAGSEADHEGTHSTK	Fibrinogen alpha	Serum	2249.95	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8528	SYKMADEAGSEADHEGTHST	Fibrinogen alpha	Serum	2121.85	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8529	KMADEAGSEADHEGTHSTKRGHAKSRPV	Fibrinogen alpha	Serum	2988.42	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8530	MADEAGSEADHEGTHSTKRGHAKSRPV	Fibrinogen alpha	Serum	2874.34	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8531	MADEAGSEADHEGTHSTKRGHAKSRPV	Fibrinogen alpha	Serum	2860.33	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8532	MADEAGSEADHEGTHSTKRGHAKSRP	Fibrinogen alpha	Serum	2761.26	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8533	MADEAGSEADHEGTHSTKRGHA	Fibrinogen alpha	Serum	2292.98	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8534	ADEAGSEADHEGTHSTKRGHAKSRPV	Fibrinogen alpha	Serum	2729.29	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8535	ADEAGSEADHEGTHSTKRGHA	Fibrinogen alpha	Serum	2161.94	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8536	DEAGSEADHEGTHSTKRGHAKSRPV	Fibrinogen alpha	Serum	2658.25	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8537	DEAGSEADHEGTHSTKRGHAKSRP	Fibrinogen alpha	Serum	2559.18	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8538	DEAGSEADHEGTHSTKRGHA	Fibrinogen alpha	Serum	2090.9	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8539	DEAGSEADHEGTHSTKRGH	Fibrinogen alpha	Serum	2019.86	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8540	DEAGSEADHEGTHSTKRG	Fibrinogen alpha	Serum	1882.8	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8541	EAGSEADHEGTHSTKRGHAKSRPV	Fibrinogen alpha	Serum	2543.22	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8542	GSEADHEGTHSTKRGHAKSRPV	Fibrinogen alpha	Serum	2343.14	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8543	GSESGIFTNTKESSSHHPGIAEFPSRG	Fibrinogen alpha	Serum	2815.32	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8544	SSKITHRIHWESASLLR	Complement C3f	Serum	2020.1	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8545	SKITHRIHWE	Complement C3f	Serum	1305.69	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8546	SKITHRIHWESASLL	Complement C3f	Serum	1776.96	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8547	KITHRIHWESASLL	Complement C3f	Serum	1689.93	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8548	THRIHWESASLL	Complement C3f	Serum	1448.75	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8549	THRIHWE	Complement C3f	Serum	977.48	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8550	HRIHWESASLL	Complement C3f	Serum	1347.7	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8551	IHWESASLL	Complement C3f	Serum	1054.54	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8552	HWESASLL	Complement C3f	Serum	941.46	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8553	HWESASLL	Complement C3f	Serum	955.48	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8554	HWESASL	Complement C3f	Serum	828.38	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8555	ASHLGLA	Complement C3f	Serum	667.37	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8556	SEETKENEGFTVTAEGK	Complement C3f	Serum	1854.85	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8557	RNGFKSHALQLNNRQI	Complement C3f	Serum	1895.02	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8558	NGFKSHALQLNNR	Complement C3f	Serum	1497.78	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8559	SHALQLNN	Complement C3f	Serum	895.45	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8560	GLEEELQFSLGSKINVKVGGNSKGTLKVLR	Complement C3f	Serum	3199.79	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8561	GLEEELQFSLGSKINVKVGGNSKGTL	Complement C3f	Serum	2703.44	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8562	GLEEELQFSLGSKINVKVGGNS	Complement C3f	Serum	2304.2	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8563	DDPDAPLQPVTPLQLFEGRRN	Complement C3f	Serum	2377.2	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8564	MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	3271.63	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8565	PGVLSSRQLGLPGPPDVPDHAAYHPF	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	2723.38	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8566	GVLSSRQLGLPGPPDVPDHAAYHPF	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	2626.33	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8567	SSRQLGLPGPPDVPDHAAYHPF	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	2357.16	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8568	QLGLPGPPDVPDHAAYHPFR	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	2183.09	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8569	QLGLPGPPDVPDHAAYHPF	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	2026.99	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8570	GLPGPPDVPDHAAYHPF	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	1785.85	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8571	GLPGPPDVPDHA	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	1170.57	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8572	GLPGPPDVPDH	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	1099.53	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8573	PGPPDVPDHA	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	1000.46	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8574	GPPDVPDHA	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	903.41	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8575	GPPDVPDH	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	832.37	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8576	NVHSGSTFFKYYLQGAKIPKPEASFSPR	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	3155.62	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8577	GSEMVVAGKLQDR	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	1388.71	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8578	AELQEGARQKLHELQEKLSPLGEEMRDRA	Aplipoprotein A-I	Serum	3374.74	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8579	QGLLPVLESFKVSFLSALEEYTKKLNTQ	Aplipoprotein A-I	Serum	3181.73	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8580	ATEHLSTLSEKAKPALEDL	Aplipoprotein A-I	Serum	2052.07	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8581	ISASAEELRQRLAPLAEDVRGNL	Aplipoprotein A-IV	Serum	2507.35	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8582	GNTEGLQKSLAELGGHLDQQVEEFR	Aplipoprotein A-IV	Serum	2754.36	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8583	KHNLGHGHKHERDQGHGHQ	Kininogen HMW	Serum	2208.05	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8584	NLGHGHKHERDQGHGHQ	Kininogen HMW	Serum	1942.9	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8585	GHGLGHGHEQQHGLGHGHKF	Kininogen HMW	Serum	2126.01	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8586	ALGISPFHEHAEVVFTANDSGPR	Transthyretin	Serum	2450.2	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8587	DSGPRRYTIAALLSPYSYSTTAVVTNPKE	Transthyretin	Serum	3156.61	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8588	ALLSPYSYSTTAVVTNPKE	Transthyretin	Serum	2040.04	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8589	SYSTTAVVTNPKE	Transthyretin	Serum	1395.69	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8590	SYSTTAVVTNPKE	Transthyretin	Serum	1409.7	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8591	SALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPKQA	Antichymotrypsin	Serum	4622.49	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8592	LVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPKQA	Antichymotrypsin	Serum	4464.42	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8593	VETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPKQA	Antichymotrypsin	Serum	4351.33	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8594	LMIIVPTDTQNIFFMSKVTNPKQA	Antichymotrypsin	Serum	2735.44	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8595	IIVPTDTQNIFFMSKVTNPKQA	Antichymotrypsin	Serum	2491.31	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8596	LEAIPMSIPPEVKFNKPFVFLMIDQNTKSPLFMGKVVNPTQK	Alpha-1 antitrypsin	Serum	4772.55	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8597	SIPPEVKFNKPFVFLMIDQNTKSPLFMGKVVNPTQK	Alpha-1 antitrypsin	Serum	4118.21	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8598	LMIDQNTKSPLFMGKVVNPTQK	Alpha-1 antitrypsin	Serum	2488.32	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8599	LEEYTKKLNTQ	Proapolipoprotein	Serum	1365.71	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8600	SRSGGGGGGGLGSGGSIRSSY	Cytokeratin	Serum	1811.85	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8601	SARLNSQRLVFNRPFLMFIVDNNILFLGKVNRP	Protein c inhibitor	Serum	3888.15	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8602	SARLNSQRLVFNRPFLMF	Protein c inhibitor	Serum	2195.18	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8603	SARLNSQRLVFNRPFLM	Protein c inhibitor	Serum	2048.11	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8604	VKVLDAVRGSPAIN	Prealbumin	Serum	1437.83	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8605	VVTNPKE	Prealbumin	Serum	785.43	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8606	DAHKSEVAHRF	Serum albumin	Serum	1295.64	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8607	DAHKSEVAHRFKD	Serum albumin	Serum	1538.76	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8608	PNHFRPAGLPEKY	SAA	Serum	1524.78	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8609	PITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE	SP40	Serum	4266.29	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8610	FQKVKEKLKIDS	Apolipoprotein CI	Serum	1461.86	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID8611	MGRVYDPRA	C1-inhibitor	Serum	1063.52	MALDI-TOF	"Breast cancer, Lung cancer, Rectal cancer"	NA	23667664
CancerPDF_ID9448	NA	Haptoglobin	Serum	NA	Affinity Column and Mass spectrometer	Lung squamous cell carcinoma	Significant higher expression in SSC patient	26783151
CancerPDF_ID9449	NA	Haptoglobin	Serum	NA	Affinity Column and Mass spectrometer	Lung squamous cell carcinoma	Significant higher expression in SSC patient	26783151
CancerPDF_ID9494	LNELEEILDVIEP	Serine/threonine-protein phosphatase 2A 56kDa regulatory subunit gamma isoform	Serum	763.38	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9495	KVVNPTQK	Alpha-1-antitrypsin	Serum	457.26	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9496	GKVVNPTQK	Alpha-1-antitrypsin	Serum	485.78	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9497	MGKVVNPTQK	Alpha-1-antitrypsin	Serum	551.29	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9498	MGKVVNPTQK	Alpha-1-antitrypsin	Serum	559.3	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9499	FMGKVVNPTQK	Alpha-1-antitrypsin	Serum	624.82	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9500	EDPQGDAAQKTD	Alpha-1-antitrypsin	Serum	637.76	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9501	EDPQGDAAQKTDT	Alpha-1-antitrypsin	Serum	688.28	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9502	SPLFMGKVVNPTQ	Alpha-1-antitrypsin	Serum	709.38	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9503	EDPQGDAAQKTDTS	Alpha-1-antitrypsin	Serum	731.81	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9504	EDPQGDAAQKTDTSH	Alpha-1-antitrypsin	Serum	533.89	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9505	DAAQKTDTSHHDQDH	Alpha-1-antitrypsin	Serum	569.24	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9506	TKSPLFMGKVVNPTQK	Alpha-1-antitrypsin	Serum	592.32	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9507	TKSPLFMGKVVNPTQK	Alpha-1-antitrypsin	Serum	597.65	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9508	AVHKAVLTIDEKGTEAAGA	Alpha-1-antitrypsin	Serum	627.67	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9509	EDPQGDAAQKTDTSHHDQ	Alpha-1-antitrypsin	Serum	660.6	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9510	AVHKAVLTIDEKGTEAAGAM	Alpha-1-antitrypsin	Serum	671.35	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9511	AVHKAVLTIDEKGTEAAGAM	Alpha-1-antitrypsin	Serum	676.68	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9512	AVHKAVLTIDEKGTEAAGAMF	Alpha-1-antitrypsin	Serum	725.71	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9513	EDPQGDAAQKTDTSHHDQDH	Alpha-1-antitrypsin	Serum	744.62	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9514	KPFVFLMIEQNTKSPLFMGKVVNPTQK	Alpha-1-antitrypsin	Serum	781.17	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9515	SPLFMGKVVNPTQK	Alpha-1-antitrypsin	Serum	521.27	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9516	EDPQGDAAQKT	Alpha-1-antitrypsin	Serum	580.25	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9517	SPLFMGKVVNPTQK	Alpha-1-antitrypsin	Serum	515.94	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9518	EDPQGDAAQKTDTSHHD	Alpha-1-antitrypsin	Serum	617.92	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9519	NTKSPLFMGKVVNPTQK	Alpha-1-antitrypsin	Serum	630.33	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9520	PVELLVAES	Alpha-1B-glycoprotein	Serum	478.75	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9521	YESDVMGR	Alpha-2-macroglobulin	Serum	478.7	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9522	VGFYESDVMGR	Alpha-2-macroglobulin	Serum	630.28	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9523	VGFYESDVMGR	Alpha-2-macroglobulin	Serum	638.28	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9524	HPNSPLDEEN	Alpha-1-antichymotrypsin	Serum	576.26	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9525	HPNSPLDEENLTQEN	Alpha-1-antichymotrypsin	Serum	868.87	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9526	HPNSPLDEENLTQENQ	Alpha-1-antichymotrypsin	Serum	932.91	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9527	HPNSPLDEENLTQENQDR	Alpha-1-antichymotrypsin	Serum	712.64	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9528	HPNSPLDEENLTQENQDRGT	Alpha-1-antichymotrypsin	Serum	765.34	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9529	CPSLGRAEGGGV	Amiloride-sensitive cation channel 4	Serum	551.75	LC-MS	Lung adenocarcinoma	Differentially expressed between Lung cancer vs control	21533267
CancerPDF_ID9530	VAPEEHPVLLTEAPLNPK	"Actin, cytoplasmic 1"	Serum	652.01	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9531	VAPDEHPILLTEAPLNPK	Beta-actin-like protein 2	Serum	652.04	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9532	QTLPPLNN	RAC-beta serine/threonine-protein kinase	Serum	448.73	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9533	VAASQAALGL	Serum albumin	Serum	450.75	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9534	LVAASQAALGL	Serum albumin	Serum	507.29	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9535	KLVAASQAALG	Serum albumin	Serum	514.81	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9536	KLVAASQAALGL	Serum albumin	Serum	571.33	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9537	DAHKSEVAHR	Serum albumin	Serum	575.27	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9538	KKLVAASQAALG	Serum albumin	Serum	578.83	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9539	GKKLVAASQAALG	Serum albumin	Serum	607.36	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9540	KKLVAASQAALGL	Serum albumin	Serum	635.38	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9541	KVPQVSTPTLVEVSR	Serum albumin	Serum	547.31	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9542	FAEEGKKLVAASQAALGL	Serum albumin	Serum	601.66	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9543	DAHKSEVAHRFK	Serum albumin	Serum	475.58	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9544	GDEELLRFSN	Protein AMBP	Serum	590.28	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9545	GVPGDGDEELLRFSN	Protein AMBP	Serum	802.88	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9546	SEDFGVNEDLADSDAR	Annexin A1	Serum	870.37	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9547	SALEEYTKKLNTQ	Apolipoprotein A-I	Serum	508.93	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9548	VSFLSALEEYTKKLNTQ	Apolipoprotein A-I	Serum	657.68	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9549	ATEHLSTLSEKAKPALEDL	Apolipoprotein A-I	Serum	685.03	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9550	AELQEGARQKLHELQEKLSPLGEEMRD	Apolipoprotein A-I	Serum	784.41	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9551	AELQEGARQKLHELQEKLSPLGEEMRDRA	Apolipoprotein A-I	Serum	841.19	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9552	EEYTKKLNTQ	Apolipoprotein A-I	Serum	627.34	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9553	VSFLSALEEYTKKLNT	Apolipoprotein A-I	Serum	615	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9554	HLDQQVEEF	Apolipoprotein A-IV	Serum	572.77	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9555	GGHLDQQVEEF	Apolipoprotein A-IV	Serum	629.77	LC-MS	Lung adenocarcinoma	Differentially expressed between Lung cancer vs control	21533267
CancerPDF_ID9556	ELGGHLDQQVEEF	Apolipoprotein A-IV	Serum	750.85	LC-MS	Lung adenocarcinoma	Differentially expressed between Lung cancer vs control	21533267
CancerPDF_ID9557	AELGGHLDQQVEEF	Apolipoprotein A-IV	Serum	786.35	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9558	SLAPYAQDTQEKLN	Apolipoprotein A-IV	Serum	789.39	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9559	SLAELGGHLDQQVEE	Apolipoprotein A-IV	Serum	812.89	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9560	LAELGGHLDQQVEEF	Apolipoprotein A-IV	Serum	842.91	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9561	SLAELGGHLDQQVEEF	Apolipoprotein A-IV	Serum	886.42	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9562	EELKARISASAEELRQ	Apolipoprotein A-IV	Serum	610.66	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9563	GNTEGLQKSLAELGGHLD	Apolipoprotein A-IV	Serum	613.65	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9564	SLAPYAQDTQEKLNHQ	Apolipoprotein A-IV	Serum	614.97	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9565	AEELKARISASAEELRQ	Apolipoprotein A-IV	Serum	634.32	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9566	SLAELGGHLDQQVEEFR	Apolipoprotein A-IV	Serum	643.32	LC-MS	Lung adenocarcinoma	Differentially expressed between Lung cancer vs control	21533267
CancerPDF_ID9567	NAEELKARISASAEELRQ	Apolipoprotein A-IV	Serum	672.34	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9568	QMKKNAEELKARISASAEELRQ	Apolipoprotein A-IV	Serum	633.34	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9569	GNTEGLQKSLAELGGHLDQQVEEF	Apolipoprotein A-IV	Serum	867.1	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9570	GNTEGLQKSLAELGGHLDQQVEEFR	Apolipoprotein A-IV	Serum	689.6	LC-MS	Lung adenocarcinoma	Differentially expressed between Lung cancer vs control	21533267
CancerPDF_ID9571	LAPLAEDVRGNL	Apolipoprotein A-IV	Serum	634.35	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9572	GNTEGLQKSLAELGGHLDQQVEEFRR	Apolipoprotein A-IV	Serum	728.62	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9573	TPDVSSALDKLKEFGN	Apolipoprotein C-I	Serum	574.28	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9574	TDQVLSVLKGEE	Apolipoprotein C-II	Serum	659.35	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9575	KDALSSVQESQVAQQA	Apolipoprotein C-III	Serum	844.92	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9576	TAKDALSSVQESQVAQQA	Apolipoprotein C-III	Serum	620.98	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9577	HATKTAKDALSSVQESQVAQQA	Apolipoprotein C-III	Serum	766.73	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9578	VGSLAGQPLQERA	Apolipoprotein E	Serum	663.36	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9579	TVGSLAGQPLQER	Apolipoprotein E	Serum	678.36	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9580	TVGSLAGQPLQERA	Apolipoprotein E	Serum	713.86	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9581	KVEQAVETEPEPEL	Apolipoprotein E	Serum	799.37	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9582	TVGSLAGQPLQERAQA	Apolipoprotein E	Serum	813.41	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9583	TVGSLAGQPLQERAQAWGE	Apolipoprotein E	Serum	999.51	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9584	KVEQAVETEPEPELRQQ	Apolipoprotein E	Serum	670.66	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9585	TVGSLAGQPLQERAQAWGERL	Apolipoprotein E	Serum	756.38	LC-MS	Lung adenocarcinoma	Differentially expressed between Lung cancer vs control	21533267
CancerPDF_ID9586	AATVGSLAGQPLQERAQAWGERL	Apolipoprotein E	Serum	803.76	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9587	SYDLDPGAGSLEI	Apolipoprotein F	Serum	668.81	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9588	DLDPGAGSLEI	Apolipoprotein F	Serum	543.76	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9589	TEPISAESGEQVER	Apolipoprotein L1	Serum	766.36	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9590	EEAGARVQQNVPSGTDTGDPQSKPLG	Apolipoprotein L1	Serum	880.07	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9591	TVKQKPSGSEMEKK	BEN domain-containing protein 7	Serum	796.93	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9592	NDDDEEEAARE	Caldesmon	Serum	646.73	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9593	TALELEEA	Uncharacterized protein C2orf27	Serum	438.2	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9594	EARLVESN	Coiled-coil domain-containing protein 11	Serum	459.23	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9595	GEGGSAPALGP	Putative uncharacterized protein C14orf181	Serum	456.72	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9596	TPWSLARPQG	Complement factor B	Serum	556.79	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9597	IHWESASLL	Complement C3	Serum	528.26	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9598	LDVSLQLPSR	Complement C3	Serum	564.34	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9599	IHWESASLLR	Complement C3	Serum	404.55	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9600	RIHWESASLLR	Complement C3	Serum	456.58	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9601	TKENEGFTVTAEG	Complement C3	Serum	691.82	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9602	EETKENEGFTVTAEG	Complement C3	Serum	820.86	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9603	SEETKENEGFTVTAEG	Complement C3	Serum	864.35	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9604	EETKENEGFTVTAEGK	Complement C3	Serum	590.26	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9605	SEETKENEGFTVTAEGK	Complement C3	Serum	619.27	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9606	HWESASLL	Complement C3	Serum	471.73	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9607	SKITHRIHWESASLLR	Complement C3	Serum	484.28	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9608	SSKITHRIHWESASLLR	Complement C3	Serum	506.03	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9609	SVQLTEK	Complement C3	Serum	402.71	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9610	GFKSHALQLNNRQ	Complement C4-A	Serum	504.93	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9611	GFKSHALQLNNRQI	Complement C4-A	Serum	542.63	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9612	NGFKSHALQLNNRQ	Complement C4-A	Serum	542.95	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9613	HALQLNN	Complement C4-A	Serum	405.2	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9614	SHALQLNN	Complement C4-A	Serum	448.72	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9615	EEELQFSLGS	Complement C4-A	Serum	569.76	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9616	NGFKSHALQLNNR	Complement C4-A	Serum	500.27	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9617	GLEEELQFS	Complement C4-B	Serum	526.24	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9618	GLEEELQFSLGSK	Complement C4-B	Serum	718.84	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9619	EEELQFSLGSKIN	Complement C4-B	Serum	747.35	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9620	EEELQFSLGSKINV	Complement C4-B	Serum	796.89	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9621	GLEEELQFSLGSKIN	Complement C4-B	Serum	832.4	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9622	NGFKSHALQLNNRQI	Complement C4-B	Serum	580.64	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9623	GLEEELQFSLGSKINV	Complement C4-B	Serum	881.97	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9624	PDAPLQPVTPLQLFEGR	Complement C4-B	Serum	626.67	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9625	GLEEELQFSLGSKINVK	Complement C4-B	Serum	630.99	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9626	DDPDAPLQPVTPLQLFEGR	Complement C4-B	Serum	703.36	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9627	GLEEELQFSLGSKINVKVGGNS	Complement C4-B	Serum	769.05	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9628	SQTSQAVTGGHTQIQAGSHTETVEQDR	Cornulin	Serum	714.09	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9629	DLMVPLGP	Cullin-9	Serum	421.2	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9630	QNTAIREEL	Cytospin-A	Serum	537.26	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9631	VGSLPGTNPA	Chromosome transmission fidelity protein 8 homolog isoform 2	Serum	456.72	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9632	EGGFTATGQR	Extracellular matrix protein 1	Serum	512.24	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9633	CLMPAVQNW	HERV-K_3q21.2 provirus ancestral Env polyprotein	Serum	531.28	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9634	LAFLPESFDGDPAS	Receptor tyrosine-protein kinase erbB-2	Serum	733.34	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9635	DLPTVELQGVVPR	Coagulation factor XIII A chain	Serum	711.9	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9636	NNSNAAEDDLPTVE	Coagulation factor XIII A chain	Serum	744.81	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9637	DDLPTVELQGVVPR	Coagulation factor XIII A chain	Serum	769.41	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9638	EDDLPTVELQGVVPR	Coagulation factor XIII A chain	Serum	833.93	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9639	AEDDLPTVELQGVVPR	Coagulation factor XIII A chain	Serum	869.45	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9640	NAAEDDLPTVELQGVVPR	Coagulation factor XIII A chain	Serum	641.65	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9641	NNSNAAEDDLPTVELQGVVPR	Coagulation factor XIII A chain	Serum	746.68	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9642	VPPNNSNAAEDDLPTVELQGVVPR	Coagulation factor XIII A chain	Serum	844.41	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9643	AVPPNNSNAAEDDLPTVELQGVVPR	Coagulation factor XIII A chain	Serum	868.08	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9644	RAVPPNNSNAAEDDLPTVELQGVVPR	Coagulation factor XIII A chain	Serum	920.12	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9645	TAFGGRRAVPPNNSNAAEDDLPTVELQGVVPR	Coagulation factor XIII A chain	Serum	837.66	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9646	TVVQPSVGAAA	Alpha-2-HS-glycoprotein	Serum	500.27	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9647	SGEVSHPRKT	Alpha-2-HS-glycoprotein	Serum	549.28	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9648	HTFMGVVSLGSPSGEVSHPRKT	Alpha-2-HS-glycoprotein	Serum	578.3	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9649	HTFMGVVSLGSPSGEVSHPRKT	Alpha-2-HS-glycoprotein	Serum	582.3	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9650	SPSGEVSHPR	Alpha-2-HS-glycoprotein	Serum	526.76	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9651	TVVQPSVGAAAG	Alpha-2-HS-glycoprotein	Serum	528.78	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9652	GVVSLGSPSGEVSHPRKT	Alpha-2-HS-glycoprotein	Serum	598.65	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9653	DFLAEGGGV	Fibrinogen alpha chain	Serum	432.69	LC-MS	Lung adenocarcinoma	Differentially expressed between Lung cancer vs control	21533267
CancerPDF_ID9654	GDSTFESKS	Fibrinogen alpha chain	Serum	479.21	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9655	DFLAEGGGVR	Fibrinogen alpha chain	Serum	510.74	LC-MS	Lung adenocarcinoma	Differentially expressed between Lung cancer vs control	21533267
CancerPDF_ID9656	EGDFLAEGGGV	Fibrinogen alpha chain	Serum	525.73	LC-MS	Lung adenocarcinoma	Differentially expressed between Lung cancer vs control	21533267
CancerPDF_ID9657	GDFLAEGGGVR	Fibrinogen alpha chain	Serum	539.25	LC-MS	Lung adenocarcinoma	Differentially expressed between Lung cancer vs control	21533267
CancerPDF_ID9658	TSSTSYNRGD	Fibrinogen alpha chain	Serum	544.23	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9659	GEGDFLAEGGGV	Fibrinogen alpha chain	Serum	554.24	LC-MS	Lung adenocarcinoma	Differentially expressed between Lung cancer vs control	21533267
CancerPDF_ID9660	GDSTFESKSY	Fibrinogen alpha chain	Serum	560.73	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9661	SGEGDFLAEGGGV	Fibrinogen alpha chain	Serum	597.75	LC-MS	Lung adenocarcinoma	Differentially expressed between Lung cancer vs control	21533267
CancerPDF_ID9662	EGDFLAEGGGVR	Fibrinogen alpha chain	Serum	603.77	LC-MS	Lung adenocarcinoma	Differentially expressed between Lung cancer vs control	21533267
CancerPDF_ID9663	DEAGSEADHEGT	Fibrinogen alpha chain	Serum	609.23	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9664	GSEADHEGTHST	Fibrinogen alpha chain	Serum	614.24	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9665	GEGDFLAEGGGVR	Fibrinogen alpha chain	Serum	632.28	LC-MS	Lung adenocarcinoma	Differentially expressed between Lung cancer vs control	21533267
CancerPDF_ID9666	AGSEADHEGTHST	Fibrinogen alpha chain	Serum	649.75	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9667	DSGEGDFLAEGGGV	Fibrinogen alpha chain	Serum	655.26	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9668	SGEGDFLAEGGGVR	Fibrinogen alpha chain	Serum	675.79	LC-MS	Lung adenocarcinoma	Differentially expressed between Lung cancer vs control	21533267
CancerPDF_ID9669	DEAGSEADHEGTH	Fibrinogen alpha chain	Serum	452.17	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9670	ADSGEGDFLAEGGGV	Fibrinogen alpha chain	Serum	690.78	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9671	TGKEKVTSGSTTTT	Fibrinogen alpha chain	Serum	699.35	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9672	FTSSTSYNRGDST	Fibrinogen alpha chain	Serum	711.81	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9673	EAGSEADHEGTHST	Fibrinogen alpha chain	Serum	714.29	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9674	DSGEGDFLAEGGGVR	Fibrinogen alpha chain	Serum	733.31	LC-MS	Lung adenocarcinoma	Differentially expressed between Lung cancer vs control	21533267
CancerPDF_ID9675	SYSKQFTSSTSYN	Fibrinogen alpha chain	Serum	750.34	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9676	ADSGEGDFLAEGGGVR	Fibrinogen alpha chain	Serum	768.83	LC-MS	Lung adenocarcinoma	Differentially expressed between Lung cancer vs control	21533267
CancerPDF_ID9677	DEAGSEADHEGTHST	Fibrinogen alpha chain	Serum	514.86	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9678	TGKEKVTSGSTTTTR	Fibrinogen alpha chain	Serum	518.6	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9679	ADEAGSEADHEGTHST	Fibrinogen alpha chain	Serum	538.54	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9680	DEAGSEADHEGTHSTK	Fibrinogen alpha chain	Serum	557.57	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9681	MADEAGSEADHEGTHST	Fibrinogen alpha chain	Serum	582.23	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9682	MADEAGSEADHEGTHST	Fibrinogen alpha chain	Serum	587.56	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9683	DEAGSEADHEGTHSTKR	Fibrinogen alpha chain	Serum	609.6	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9684	AGSEADHEGTHSTKRGHA	Fibrinogen alpha chain	Serum	616.62	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9685	KMADEAGSEADHEGTHST	Fibrinogen alpha chain	Serum	624.91	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9686	MADEAGSEADHEGTHSTK	Fibrinogen alpha chain	Serum	624.93	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9687	DEAGSEADHEGTHSTKRG	Fibrinogen alpha chain	Serum	628.59	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9688	KMADEAGSEADHEGTHST	Fibrinogen alpha chain	Serum	630.26	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9689	ADEAGSEADHEGTHSTKRG	Fibrinogen alpha chain	Serum	652.28	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9690	SSSYSKQFTSSTSYNRGD	Fibrinogen alpha chain	Serum	667.97	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9691	DEAGSEADHEGTHSTKRGH	Fibrinogen alpha chain	Serum	674.28	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9692	DEAGSEADHEGTHSTKRGHA	Fibrinogen alpha chain	Serum	697.96	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9693	SSYSKQFTSSTSYNRGDST	Fibrinogen alpha chain	Serum	701.65	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9694	SYKMADEAGSEADHEGTHST	Fibrinogen alpha chain	Serum	708.28	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9695	SYKMADEAGSEADHEGTHST	Fibrinogen alpha chain	Serum	713.6	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9696	ADEAGSEADHEGTHSTKRGHA	Fibrinogen alpha chain	Serum	721.63	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9697	SSSYSKQFTSSTSYNRGDST	Fibrinogen alpha chain	Serum	730.66	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9698	MADEAGSEADHEGTHSTKRGHA	Fibrinogen alpha chain	Serum	574.25	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9699	MADEAGSEADHEGTHSTKRGHA	Fibrinogen alpha chain	Serum	770.65	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9700	SYKMADEAGSEADHEGTHSTKR	Fibrinogen alpha chain	Serum	602.52	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9701	KMADEAGSEADHEGTHSTKRGHA	Fibrinogen alpha chain	Serum	606.26	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9702	KMADEAGSEADHEGTHSTKRGHA	Fibrinogen alpha chain	Serum	610.27	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9703	SYKMADEAGSEADHEGTHSTKRG	Fibrinogen alpha chain	Serum	616.77	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9704	ESKSYKMADEAGSEADHEGTHST	Fibrinogen alpha chain	Serum	617.51	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9705	SYKMADEAGSEADHEGTHSTKRGHA	Fibrinogen alpha chain	Serum	668.78	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9706	SYKMADEAGSEADHEGTHSTKRGHA	Fibrinogen alpha chain	Serum	672.78	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9707	GDSTFESKSYKMADEAGSEADHEGTHST	Fibrinogen alpha chain	Serum	744.3	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9708	KMADEAGSEADHEGTHSTKRGHAKSRPV	Fibrinogen alpha chain	Serum	748.1	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9709	GDSTFESKSYKMADEAGSEADHEGTHST	Fibrinogen alpha chain	Serum	748.3	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9710	SYKMADEAGSEADHEGTHSTKRGHAKSRPV	Fibrinogen alpha chain	Serum	810.62	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9711	NRGDSTFESKSYKMADEAGSEADHEGTHST	Fibrinogen alpha chain	Serum	811.9	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9712	SYKMADEAGSEADHEGTHSTKRGHAKSRPV	Fibrinogen alpha chain	Serum	814.61	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9713	SETESRGSESGIFTNTKESSSHHPGIAEFPSRG	Fibrinogen alpha chain	Serum	877.17	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9714	GDSTFESK	Fibrinogen alpha chain	Serum	435.69	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9715	FLAEGGGVR	Fibrinogen alpha chain	Serum	453.25	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9716	GDFLAEGGGV	Fibrinogen alpha chain	Serum	461.21	LC-MS	Lung adenocarcinoma	Differentially expressed between Lung cancer vs control	21533267
CancerPDF_ID9717	DSTFESKSY	Fibrinogen alpha chain	Serum	532.24	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9718	SSSYSKQFTS	Fibrinogen alpha chain	Serum	561.25	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9719	TSSTSYNRGDST	Fibrinogen alpha chain	Serum	638.28	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9720	DEAAFFDTASTGK	Fibrinogen alpha chain	Serum	680.32	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9721	QFTSSTSYNRGDST	Fibrinogen alpha chain	Serum	775.83	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9722	STSYNRGDSTFESKS	Fibrinogen alpha chain	Serum	555.91	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9723	NRGDSTFESKSYKMA	Fibrinogen alpha chain	Serum	574.26	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9724	FTSSTSYNRGDSTFES	Fibrinogen alpha chain	Serum	893.38	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9725	SSSYSKQFTSSTSYNRGDSTF	Fibrinogen alpha chain	Serum	779.69	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9726	FTSSTSYNRGDSTFESKSYKM	Fibrinogen alpha chain	Serum	606.54	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9727	YKMADEAGSEADHEGTHSTKRGHA	Fibrinogen alpha chain	Serum	647.04	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9728	SSSYSKQFTSSTSYNRGDSTFESKSYKM	Fibrinogen alpha chain	Serum	798.36	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9729	SSSYSKQF	Fibrinogen alpha chain	Serum	467.22	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9730	KEKVTSGSTTTT	Fibrinogen alpha chain	Serum	620.33	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9731	SKQFTSSTSYN	Fibrinogen alpha chain	Serum	625.3	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9732	NRGDSTFESKSY	Fibrinogen alpha chain	Serum	464.2	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9733	DSHSLTTNIMEIL	Fibrinogen alpha chain	Serum	737.37	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9734	SSYSKQFTSSTSYN	Fibrinogen alpha chain	Serum	793.85	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9735	DSHSLTTNIMEILR	Fibrinogen alpha chain	Serum	543.96	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9736	TSSTSYNRGDSTFES	Fibrinogen alpha chain	Serum	819.86	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9737	NRGDSTFESKSYKM	Fibrinogen alpha chain	Serum	550.6	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9738	NRGDSTFESKSYKM	Fibrinogen alpha chain	Serum	555.92	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9739	SSSYSKQFTSSTSYN	Fibrinogen alpha chain	Serum	837.36	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9740	NRGDSTFESKSYKMA	Fibrinogen alpha chain	Serum	579.6	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9741	HRHPDEAAFFDTASTG	Fibrinogen alpha chain	Serum	586.92	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9742	GSEADHEGTHSTKRGHA	Fibrinogen alpha chain	Serum	592.93	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9743	SSSYSKQFTSSTSYNR	Fibrinogen alpha chain	Serum	610.61	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9744	NRGDSTFESKSYKMAD	Fibrinogen alpha chain	Serum	612.6	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9745	HRHPDEAAFFDTASTGK	Fibrinogen alpha chain	Serum	629.62	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9746	MADEAGSEADHEGTHSTK	Fibrinogen alpha chain	Serum	630.26	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9747	QFTSSTSYNRGDSTFES	Fibrinogen alpha chain	Serum	957.41	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9748	SYKMADEAGSEADHEGTH	Fibrinogen alpha chain	Serum	645.59	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9749	SYKMADEAGSEADHEGTH	Fibrinogen alpha chain	Serum	650.93	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9750	EAGSEADHEGTHSTKRGHA	Fibrinogen alpha chain	Serum	659.63	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9751	SYKMADEAGSEADHEGTHS	Fibrinogen alpha chain	Serum	674.62	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9752	MADEAGSEADHEGTHSTKR	Fibrinogen alpha chain	Serum	676.95	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9753	YKMADEAGSEADHEGTHST	Fibrinogen alpha chain	Serum	679.28	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9754	MADEAGSEADHEGTHSTKR	Fibrinogen alpha chain	Serum	682.29	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9755	SYKMADEAGSEADHEGTHSTK	Fibrinogen alpha chain	Serum	563.5	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9756	SYKMADEAGSEADHEGTHSTK	Fibrinogen alpha chain	Serum	567.5	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9757	SYKMADEAGSEADHEGTHSTKR	Fibrinogen alpha chain	Serum	606.52	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9758	SYKMADEAGSEADHEGTHSTKRG	Fibrinogen alpha chain	Serum	620.77	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9759	ESKSYKMADEAGSEADHEGTHSTKRGHA	Fibrinogen alpha chain	Serum	754.84	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9760	ESKSYKMADEAGSEADHEGTHSTKRGHA	Fibrinogen alpha chain	Serum	758.86	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9761	NRGDSTFESKSYKMADEAGSEADHEGTHST	Fibrinogen alpha chain	Serum	815.87	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9762	YNRGDSTFESKSYKMADEAGSEADHEGTHST	Fibrinogen alpha chain	Serum	852.64	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9763	GDSTFESKSYKMADEAGSEADHEGTHSTKRGHA	Fibrinogen alpha chain	Serum	881.7	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9764	EEAPSLRPAPPPISGGGY	Fibrinogen beta chain	Serum	897.92	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9765	NEEGFFSA	Fibrinogen beta chain	Serum	450.68	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9766	NDNEEGFFSA	Fibrinogen beta chain	Serum	565.21	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9767	KVVPNNDK	Filamin-C	Serum	457.27	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9768	ESPASPSE	Fos-related antigen 2	Serum	402.18	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9769	ATASRGASQAGAPQGRVPEARPN	Gelsolin	Serum	563.04	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9770	TASRGASQAGAPQGR	Gelsolin	Serum	472.23	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9771	STLVTER	ARF GTPase-activating protein GIT1	Serum	403.22	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9772	PEPAKSAPAPK	Histone H2B type 1-C/E/F/G/I	Serum	546.8	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9773	ALAHKYH	Hemoglobin subunit beta	Serum	420.22	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9774	LGGHLDAK	Haptoglobin	Serum	405.72	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9775	VDSGNDVTDIADD	Haptoglobin	Serum	668.28	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9776	VDSGNDVTDIADDG	Haptoglobin	Serum	696.79	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9777	VDSGNDVTDIAD	Haptoglobin	Serum	610.76	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9778	SIQDWVQKTIAEN	Haptoglobin	Serum	766.41	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9779	LGGHLDAKG	Haptoglobin-related protein	Serum	434.22	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9780	ILGGHLDAK	Haptoglobin-related protein	Serum	462.26	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9781	ILGGHLDAKG	Haptoglobin-related protein	Serum	490.76	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9782	KPKNPANPVQ	Haptoglobin-related protein	Serum	546.8	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9783	GKPKNPANPVQ	Haptoglobin-related protein	Serum	575.32	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9784	EVQLLESGGGLVQPG	Ig heavy chain V-III region VH26	Serum	741.89	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9785	EVQLLESGGGLVQPGG	Ig heavy chain V-III region VH26	Serum	770.4	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9786	EVQLVESG	Ig heavy chain V-III region BRO	Serum	430.72	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9787	EVQLVESGGGLVQ	Ig heavy chain V-III region BRO	Serum	657.85	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9788	EVQLVESGGGLVQPG	Ig heavy chain V-III region BRO	Serum	734.86	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9789	EVQLVESGGGLVQPGG	Ig heavy chain V-III region BRO	Serum	763.38	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9790	EVQLVESGG	Ig heavy chain V-III region BRO	Serum	459.23	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9791	QVELVESGGGVVEPGRSLRL	Ig heavy chain V-III region CAM	Serum	1041.04	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9792	QVKLVQAGGGVVQPGR	Ig heavy chain V-III region HIL	Serum	796.92	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9793	YTQKSLSLSPG	Ig gamma-1 chain C region	Serum	590.83	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9794	LHNHYTQKSLSLSPG	Ig gamma-1 chain C region	Serum	561.29	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9795	TQKSLSLSPG	Ig gamma-2 chain C region	Serum	509.27	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9796	ALHNHYTQKSLSLSPG	Ig gamma-2 chain C region	Serum	584.97	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9797	TSKEEDDSENGV	Inward rectifier potassium channel 2	Serum	655.27	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9798	PGPPDVPDH	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	465.7	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9799	PGVLSSRQL	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	478.77	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9800	PGPPDVPDHA	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	501.23	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9801	LPGPPDVPDH	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	522.25	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9802	GLPGPPDVPDH	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	550.75	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9803	LPGPPDVPDHA	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	557.77	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9804	GSEMVVAGKLQ	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	567.79	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9805	GLPGPPDVPDHA	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	586.27	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9806	GLPGPPDVPDHAA	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	621.81	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9807	GLPGPPDVPDHAAY	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	703.34	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9808	GVLSSRQLGLPGPPD	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	746.88	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9809	AVEEVTQNNFRLL	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	766.9	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9810	PGVLSSRQLGLPGPPD	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	795.43	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9811	PGPPDVPDHAAYHPF	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	808.85	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9812	SRQLGLPGPPDVPDHA	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	552.62	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9813	GVLSSRQLGLPGPPDVPDHA	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	671.34	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9814	PGVLSSRQLGLPGPPDVPDHAA	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	727.39	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9815	PGVLSSRQLGLPGPPDVPDHAAYHP	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	645.07	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9816	PGVLSSRQLGLPGPPDVPDHAAYHPF	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	681.83	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9817	SEMVVAGKLQ	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	531.28	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9818	GSEMVVAGKLQ	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	559.79	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9819	IPKPEASFSPR	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	410.23	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9820	GSEMVVAGKLQDR	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	463.91	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9821	GSEMVVAGKLQDR	Inter-alpha-trypsin inhibitor heavy chain H4	Serum	469.24	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9822	RNVSTGDVNVE	"Keratin, type I cytoskeletal 10"	Serum	595.3	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9823	EVFTSSSSSSSR	"Keratin, type I cytoskeletal 16"	Serum	630.78	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9824	SRSGGGGGGGLGSGGSIRSSY	"Keratin, type I cytoskeletal 9"	Serum	604.96	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9825	STATVVASSAPGV	Basic helix-loop-helix domain-containing protein KIAA2018	Serum	573.8	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9826	GPGGYPGGIH	"Keratin, type II cytoskeletal 2 epidermal"	Serum	456.23	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9827	SRHGGGGGGFGGGGFGSRSL	"Keratin, type II cytoskeletal 2 epidermal"	Serum	588.63	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9828	GGSGGGGGGSSGGRGSGGGSSGGSIGGR	"Keratin, type II cytoskeletal 1"	Serum	693.97	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9829	SFSTASAITPSVSR	"Keratin, type II cytoskeletal 5"	Serum	705.86	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9830	SGFSSVSVSR	"Keratin, type II cytoskeletal 6A"	Serum	506.75	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9831	AIGGGLSSVGGGSSTIKY	"Keratin, type II cytoskeletal 6A"	Serum	805.92	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9832	AIGGGLSSVGGGSSTIKYTTTSSSSR	"Keratin, type II cytoskeletal 6A"	Serum	806.74	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9833	SGFSSISVSR	"Keratin, type II cytoskeletal 6C"	Serum	513.75	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9834	EATAKAVLEPI	KLRAQ motif-containing protein 1	Serum	571.35	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9835	DDDLEHQ	Kininogen-1	Serum	436.16	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9836	DDDLEHQGGH	Kininogen-1	Serum	561.72	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9837	DDDLEHQGGHVLDH	Kininogen-1	Serum	529.56	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9838	KHNLGHGHKHERDQGHGHQ	Kininogen-1	Serum	737.02	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9839	DIQMTQSPSSLSA	Ig kappa chain V-I region AG	Serum	690.8	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9840	DIQMTQSPSSLSASVGNRVTIT	Ig kappa chain V-I region OU	Serum	764.73	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9841	EIVLTQSPGTLSL	Ig kappa chain V-III region SIE	Serum	679.39	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9842	DIVMTQSPDSLAVSLGERATIN	Ig kappa chain V-IV region (Fragment)	Serum	773.08	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9843	ELDKWAKI	Kynureninase	Serum	501.75	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9844	STVEKTVAPTECS	Ig lambda chain C regions	Serum	676.32	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9845	FLLSLVLT	Limbin	Serum	453.26	LC-MS	Lung adenocarcinoma	Differentially expressed between Lung cancer vs control	21533267
CancerPDF_ID9846	MGIAGLVLVVLG	Leukocyte immunoglobulin-like receptor subfamily A member 1	Serum	571.35	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9847	DGVNTVTVPG	MACRO domain-containing protein 2	Serum	479.76	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9848	AINGSGNAENR	"Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3"	Serum	551.76	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9849	ERQEAEEAKEALLQ	Moesin	Serum	548.61	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9850	PVTVTRTTITTTT	Myeloid-associated differentiation marker	Serum	696.38	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9851	NSRSAVVEL	Nucleus accumbens-associated protein 1	Serum	487.77	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9852	GGPGGAGVARGGAGGGP	Neurogranin	Serum	626.31	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9853	KGPGPGGPGGAGVARGGAGGGP	Neurogranin	Serum	563.31	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9854	MFLSDNPN	Niemann-Pick C1 protein	Serum	477.18	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9855	KEQENRKGL	Protein DJ-1	Serum	551.3	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9856	EILESEEKGDPNKPSGF	PDZ and LIM domain protein 1	Serum	625.96	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9857	VSSGATALRN	Plakophilin-4	Serum	488.24	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9858	ICCIAEVLIT	PMS1 protein homolog 1	Serum	539.25	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9859	FLPLGLALGL	Prostasin	Serum	507.29	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9860	DTNRASVGQDSPEPR	Plexin domain-containing protein 2	Serum	543.59	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9861	DIQGQQSLRL	Ras association domain-containing protein 8	Serum	579.29	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9862	EMAEDPLT	Rho-related BTB domain-containing protein 2	Serum	453.23	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9863	EAFTVPLIPLGL	Putative rhophilin-2-like protein	Serum	635.38	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9864	FGHGAEDSLADQA	Serum amyloid A protein	Serum	659.32	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9865	FGHGAEDSLADQAANEWG	Serum amyloid A protein	Serum	937.88	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9866	EGEIAEEAAEKA	Serum deprivation-response protein	Serum	623.77	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9867	EGEIAEEAAEKAT	Serum deprivation-response protein	Serum	674.29	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9868	VEGEIAEEAAEKAT	Serum deprivation-response protein	Serum	723.83	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9869	LVEGEIAEEAAEKAT	Serum deprivation-response protein	Serum	780.37	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9870	SALVEGEIAEEAAEKAT	Serum deprivation-response protein	Serum	573.28	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9871	VEGEIAEEAAEKA	Serum deprivation-response protein	Serum	673.34	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9872	VEGEIAEEAAEKATS	Serum deprivation-response protein	Serum	767.38	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9873	AENETKSEDLPSSE	Serum deprivation-response protein	Serum	768.34	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9874	GAVEGKEELPDENKSLE	Serum deprivation-response protein	Serum	615.3	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9875	DRNLPSDSQDLGQHG	Serglycin	Serum	546.91	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9876	SLDRNLPSDSQDLGQHG	Serglycin	Serum	613.61	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9877	NLPSDSQDLGQHGLEED	Serglycin	Serum	927.38	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9878	SLDRNLPSDSQDLGQHGLEED	Serglycin	Serum	775.68	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9879	SLDRNLPSDSQDLGQHGLEEDFM	Serglycin	Serum	873.71	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9880	SLDRNLPSDSQDLGQHGLEEDFM	Serglycin	Serum	868.4	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9881	TSIEMAEG	Serine/threonine-protein kinase 3	Serum	419.17	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9882	SDNQLQEGKNVIGLQ	Transgelin-2	Serum	821.91	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9883	TVVPGGDLAKVQ	Tubulin alpha-4A chain	Serum	592.34	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9884	DLEPTVIDEIR	Tubulin alpha-4A chain	Serum	650.35	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9885	DGALNVDLTEFQTN	Tubulin alpha-4A chain	Serum	768.86	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9886	VLEEDEEVTEEAEMEPEDKGH	Tubulin beta-1 chain	Serum	815.37	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9887	EEDEEVTEEAEMEPEDKGH	Tubulin beta-1 chain	Serum	744.64	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9888	SVVPSPKVSDTVVEPYNATLSVH	Tubulin beta-4 chain	Serum	809.11	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9889	SLEDKTERE	Prothrombin	Serum	553.77	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9890	FEKKSLEDKTERE	Prothrombin	Serum	546.94	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9891	EETGDGLDEDSDRAIEG	Prothrombin	Serum	904.37	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9892	EDKTERELLESYIDGR	Prothrombin	Serum	651.66	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9893	SLEDKTERELLESYIDGR	Prothrombin	Serum	718.35	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9894	TATSEYQTFFNPR	Prothrombin	Serum	781.36	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9895	DKTERELLESYIDGR	Prothrombin	Serum	608.65	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9896	GLDEDSDRAIEG	Prothrombin	Serum	638.78	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9897	KNPLPSKETIEQEKQAGES	Thymosin beta-4-like protein 1	Serum	705.03	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9898	KTETQEKNPLPSKETIEQEKQAGES	Thymosin beta-4-like protein 1	Serum	708.12	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9899	TAVVTNPKE	Transthyretin	Serum	479.76	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9900	TTAVVTNPKE	Transthyretin	Serum	530.27	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9901	STTAVVTNPKE	Transthyretin	Serum	573.79	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9902	YSTTAVVTNPKE	Transthyretin	Serum	655.31	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9903	SYSTTAVVTNPKE	Transthyretin	Serum	698.82	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9904	YSYSTTAVVTNPKE	Transthyretin	Serum	780.35	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9905	EHAEVVFTANDSGPR	Transthyretin	Serum	543.59	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9906	SPYSYSTTAVVTNPKE	Transthyretin	Serum	872.4	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9907	HEHAEVVFTANDSGPR	Transthyretin	Serum	589.28	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9908	LLSPYSYSTTAVVTNPKE	Transthyretin	Serum	657.34	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9909	YTIAALLSPYSYSTTAVVTNPKE	Transthyretin	Serum	830.43	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9910	RYTIAALLSPYSYSTTAVVTNPKE	Transthyretin	Serum	882.46	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9911	DSGPRRYTIAALLSPYSYSTTAVVTNPKE	Transthyretin	Serum	790.14	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9912	FTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE	Transthyretin	Serum	898.48	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9913	SGPRRYTIAALLSPYSYSTTAVVTNPKE	Transthyretin	Serum	761.42	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9914	EKTPKDESANQEEPEARVPAQ	Vasodilator-stimulated phosphoprotein	Serum	785.04	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9915	SEIDAELKNIL	Vitamin D-binding protein	Serum	622.82	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9916	EEEAPAPEVGASKPEGI	Vitronectin	Serum	855.41	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID9917	PGPLTLKEVEELEQ	Zyxin	Serum	791.43	LC-MS	Lung adenocarcinoma	"Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal"	21533267
CancerPDF_ID11071	DSGEGDFLAEGGGVR	Fibrinogen alpha chain	Serum	1545.6249	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Differentially expressed between cancer vs normal	27043541
CancerPDF_ID11072	SPMYSIITPNILR	CO3_HUMAN	Serum	1520.8456	MALDI-TOF	Non-small cell lung cancer (NSCLC)	Differentially expressed between cancer vs normal	27043541