Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID4049 | AAGQQQPPREPPAAPGAWRQQI | Protein-lysine 6-oxidase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4050 | AAGQQQPPREPPAAPGAWRQQIQ | Protein-lysine 6-oxidase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4051 | AAGQQQPPREPPAAPGAWRQQIQWENNGQV | Protein-lysine 6-oxidase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4187 | AGQQQPPREPPAAPGAWRQQ | Protein-lysine 6-oxidase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4188 | AGQQQPPREPPAAPGAWRQQI | Protein-lysine 6-oxidase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4189 | AGQQQPPREPPAAPGAWRQQIQ | Protein-lysine 6-oxidase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5278 | GQPKAAPSVTLFPPSSEELQANKATLVCLISDF | hypothetical protein XP_002348153 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5282 | GQQQPPREPPAAPGAWRQQIQ | Protein-lysine 6-oxidase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6387 | PAAGQQQPPREPPAAPGAWRQ | Protein-lysine 6-oxidase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6388 | PAAGQQQPPREPPAAPGAWRQQI | Protein-lysine 6-oxidase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6389 | PAAGQQQPPREPPAAPGAWRQQIQ | Protein-lysine 6-oxidase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6573 | QQQPPREPPAAPGAWR | Protein-lysine 6-oxidase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |