Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID4296 | ANKATLVCLISDFYPGAVT | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4471 | CLISDFYPGAV | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4478 | CLISDFYPGAVT | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4854 | FGGGTKLTV | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4861 | FGGGTKLTVLGQPKAAPSV | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5267 | GQPKAAPSVTLFPPSSEELQANKATL | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5270 | GQPKAAPSVTLFPPSSEELQANKATLV | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5274 | GQPKAAPSVTLFPPSSEELQANKATLVCL | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5277 | GQPKAAPSVTLFPPSSEELQANKATLVCLI | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5320 | GVFGGGTKL | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5366 | HEGSTVEKTVAPTE | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5371 | HEGSTVEKTVAPTECS | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5575 | KATLVCLISDFYPGAVT | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5783 | LFPPSSEELQANKATLVCLISDFYPGAV | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5791 | LFPPSSEELQANKATLVCLISDFYPGAVT | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5802 | LFPPSSEELQANKATLVCLISDFYPGAVTV | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5832 | LGQPKAAPSVTLFPPSSEELQANKA | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5839 | LGQPKAAPSVTLFPPSSEELQANKATLV | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5876 | LISDFYPGAVTV | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6299 | NKATLVCLISDFYPGAVT | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7305 | SWYQQLPGTAPK | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7306 | SWYQQLPGTAPKLLI | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7403 | TGLQTGDEADYY | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7489 | TLFPPSSEELQANKATLVCLISDFYPGAVTV | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7529 | TLVCLISDFYPGAVT | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7540 | TLVCLISDFYPGAVTV | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7720 | VAWKADSSPVKAGVE | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7729 | VAWKADSSPVKAGVETTTPSKQSNNKYAAS | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7733 | VAWKADSSPVKAGVETTTPSKQSNNKYAASSY | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7739 | VCLISDFYPGAVT | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7784 | VEKTVAPTECS | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7811 | VFGGGTKLTV | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7820 | VFGGGTKLTVL | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8223 | WYQQLPGTAPKLLI | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8352 | YQQLPGTAPKL | Lambda-chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |