Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID12730 | QAGAAGSRMNFRPGVLS | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 1717.941 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.91 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.93, Upregulated in BC vs healthy with 1.276 fold change" | 27058005 |
| CancerPDF_ID12731 | QAGAAGSRMNFRPGVLSS | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 1804.918 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.93 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.04, Upregulated in BC vs healthy with 1.080 fold change" | 27058005 |
| CancerPDF_ID12732 | YLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 1889.031 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.14 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.08, Upregulated in BC vs healthy with 1.244 fold change" | 27058005 |
| CancerPDF_ID12733 | YYLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 2051.125 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.80 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.02, Upregulated in BC vs healthy with 1.047 fold change" | 27058005 |
| CancerPDF_ID12734 | SRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 2271.203 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.99 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.93, Upregulated in BC vs healthy with 1.221 fold change" | 27058005 |
| CancerPDF_ID12735 | NVHSGSTFFKYYLQGAKIPKPEA | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 2582.393 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.38 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.62, Upregulated in BC vs healthy with 0.975 fold change" | 27058005 |
| CancerPDF_ID12736 | GVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 2627.365 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.51 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.86, Upregulated in BC vs healthy with 0.931 fold change" | 27058005 |
| CancerPDF_ID12737 | PGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 2724.46 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.22 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.72, Upregulated in BC vs healthy with 1.080 fold change" | 27058005 |
| CancerPDF_ID12738 | NVHSGSTFFKYYLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 3156.679 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.52 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.11, Upregulated in BC vs healthy with 1.158 fold change" | 27058005 |
| CancerPDF_ID12739 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 3272.752 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.42 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.89, Upregulated in BC vs healthy with 1.036 fold change" | 27058005 |
| CancerPDF_ID12740 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 3288.759 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.34 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.85, Upregulated in BC vs healthy with 1.126 fold change" | 27058005 |
| CancerPDF_ID12741 | QAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 3969.989 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.57 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.82, Upregulated in BC vs healthy with 1.170 fold change" | 27058005 |