Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID46 | HAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 842.4 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID47 | GPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 1519.7 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID48 | PGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H6 | Serum | 808.81 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID49 | GLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H7 | Serum | 1786.86 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID50 | QLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H8 | Serum | 2028.01 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID51 | SRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H9 | Serum | 2271.14 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID52 | SSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H10 | Serum | 2358.09 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID53 | GVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H11 | Serum | 2627.48 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID54 | PGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H12 | Serum | 2724.48 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID55 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H13 | Serum | 3272.5 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID56 | QAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H14 | Serum | 3970.97 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID57 | QLGLPGPPDVPDHAAYHPFR | Inter-alpha-trypsin inhibitor heavy chain H15 | Serum | 2183.91 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID58 | HAAYHPFR | Inter-alpha-trypsin inhibitor heavy chain H16 | Serum | 998.45 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID59 | NVHSGSTFFKYYLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H17 | Serum | 3156.52 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID60 | NVHSGSTFFKYYLQGAKIPKPEA | Inter-alpha-trypsin inhibitor heavy chain H18 | Serum | 861.39 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID61 | YYLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H19 | Serum | 684.63 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID62 | NVHSAGAAGSRMNFRPGVLSS | PRO1851(ITIH4 splice variant) | Serum | 2115.01 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID160 | ALTQNHHKQYYEGSE | "Inter-alpha-trypsin inhibitor, heavy chain" | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID204 | NVHSGSTFFKYYLQGAKIPKPEASFSPR | inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 3156.6207 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS | 19728888 |
| CancerPDF_ID249 | NVHSGSTFFKYYLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 3156.6207 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID769 | YYLQGAKIPKPEA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 493.27 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID770 | YLQGAKIPKPEAS | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | "701.38, 467.92" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID771 | YLQGAKIPKPEA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 438.91 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID772 | QGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 538.29 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID773 | KIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 452.92 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID774 | PGVLSSRQLGLPGPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 703.7 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID775 | SSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 786.72 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID776 | SSRQLGLPGPPDVPDHAA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 605.31 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID777 | SSRQLGLPGPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 581.63 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID778 | SRQLGLPGPPDVPDHAA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 576.29 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID779 | SRQLGLPGPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 552.6 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID780 | RQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 728.7 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID781 | RQLGLPGPPDVPDHAA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 547.28 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID782 | RQLGLPGPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 523.61 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID783 | QLGLPGPPDVPDHAAYHPFR | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 728.69 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID784 | QLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 676.66 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID785 | QLGLPGPPDVPDHAAY | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 823.91 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID786 | QLGLPGPPDVPDHAA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 742.38 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID787 | QLGLPGPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 706.86 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID788 | LGLPGPPDVPDHAA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 678.34 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID789 | GLPGPPDVPDHAA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 621.81 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID790 | GLPGPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 586.28 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID791 | GLPGPPDVPDH | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 550.76 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID792 | GLPGPPDVPD | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 482.23 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID793 | PGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 808.87 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID794 | PGPPDVPDHAA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 536.75 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID795 | PGPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 501.23 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID796 | GPPDVPDHAAYHPFR | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 559.26 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID797 | GPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 760.34 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID798 | GPPDVPDHAAYHP | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 686.81 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID799 | GPPDVPDHAAY | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 569.75 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID800 | PDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 527.73 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID801 | PGVLSSRQL | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 478.77 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID802 | GPDVLTATVSGK | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 572.81 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID803 | GSEMVVAGKLQDR | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | "695.35, 463.90" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID804 | GSEMVVAGKLQD | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 617.31 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID805 | GSEMVVAGKLQ | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 559.79 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID806 | SEMVVAGKLQDR | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 444.89 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID807 | SEMVVAGKLQD | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 588.79 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID808 | SEMVVAGKLQ | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 531.28 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID809 | EMVVAGKLQD | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 545.28 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID810 | EMVVAGKLQ | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 487.76 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID811 | MNFRPGVLSSR | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 632.33 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID812 | MNFRPGVLS | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 510.76 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID813 | MNFRPGVL | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 467.24 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID814 | NFRPGVLSSR | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 566.81 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID815 | NFRPGVLS | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 445.24 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID816 | FRPGVLSSR | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 509.79 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID817 | GVLSSRQL | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 430.25 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID818 | GAAGSRMNFRPGVLSS | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 536.27 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID819 | AEDHFSVIDFNQNIR | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 602.28 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID820 | NVKENIQDNISLF | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 767.39 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID821 | FYNQVSTPLLR | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 669.36 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID1059 | HAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 842.4 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in Prostate cancer vs normal,Downregulated in Bladder cancer vs normal with Ratio of median intensity (patients/Controls) =1.49, 0.01 and 1.04 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1060 | GLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 1786.86 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =2.39, 2.88 and 2.3 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1061 | QLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H6 | Serum | 2028.01 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1062 | SRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H7 | Serum | 2271.14 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =4.58, 2.64 and 1.46 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1063 | SSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H8 | Serum | 2358.09 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =100, 73 and 531 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1064 | GVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H9 | Serum | 2627.48 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =2.24, 0.26 and 1.07 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1065 | PGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H10 | Serum | 2724.48 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.75, 6.17 and 1.64 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1066 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H11 | Serum | 3272.5 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1, 1277 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1067 | QAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H12 | Serum | 3970.97 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1, 957 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1068 | QLGLPGPPDVPDHAAYHPFR | Inter-alpha-trypsin inhibitor heavy chain H13 | Serum | 2183.91 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.71, 1.79 and 2.83 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1069 | HAAYHPFR | Inter-alpha-trypsin inhibitor heavy chain H14 | Serum | 998.45 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =121, 256 and 147 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1070 | NVHSGSTFFKYYLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H15 | Serum | 3156.52 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =3.43, 10.68 and 1.33 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1853 | GSEMVVAGK | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 876.4375 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1854 | GPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 903.40865 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1855 | GSEMVVAGKLQ | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1117.58014 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1856 | GSEMVVAGKLQDR | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1388.7082 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1857 | TLRVQGNDHSATRE | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1582.78118 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1858 | YLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1888.02068 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1859 | GNDHSATRER | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1141.52245 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1860 | PGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1615.74194 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1861 | YYLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 2051.08401 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1862 | GLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1785.84747 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1863 | QGPVNLLSDPEQGVEVTGQYEREK | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 2671.30894 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1864 | EMVVAGKLQ | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 973.52665 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1865 | GLPGPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1170.56694 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1866 | TLRVQGNDHSATRER | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1738.88229 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1867 | RVQGNDHSATRER | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1524.75055 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1868 | ANTVQEATFQMELPK | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1705.83452 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1869 | TLRVQGNDHSAT | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1297.63748 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1870 | TLRVQGNDHSATR | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1453.73859 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1871 | LRVQGNDHSATRER | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1637.83461 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1872 | NPLVWVHASPEHVVVTR | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1939.04281 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1873 | NPLVWVHASPEHVVVT | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1782.9417 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1874 | TFEYPSNAVEEVTQNNF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1987.87995 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1875 | QGPVNLLSDPEQGVEVTGQYERE | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 2543.21398 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1876 | EKNGIDIYSLTVDSR | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1708.86318 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2240 | EAEDEAGMQGPGPRD | Junctophilin-4 | Serum | 1573.63146 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID3014 | QAGAAGSR | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 716.3566 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3015 | VRPQQLV | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 838.5025 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3016 | NFRPGVLSS | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 975.5138 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3017 | IQQTREALI | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 1070.6084 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3018 | FKPTLSQQQ | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 1075.5662 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3019 | MNFRPGVLSS | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 1106.5543 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3020 | NFRPGVLSSR | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 1131.6149 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3021 | ETLFSVMPGLK | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 1220.6475 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3022 | MNFRPGVLSSR | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 1262.6554 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3023 | NRNVHSGSTFF | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 1264.5949 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3024 | NRNVHSGSTFFK | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 1392.6898 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3025 | WKETLFSVMPGL | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 1406.7268 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3026 | WKETLFSVMPGLK | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 1534.8218 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3027 | AHIRFKPTLSQQQ | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 1552.8474 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3028 | TLRVQGNDHSATRER | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 1738.8823 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3029 | NPLVWVHASPEHVVVT | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 1782.9417 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3030 | QLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 2026.9901 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3031 | YYLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 2051.084 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3032 | NPLVWVHASPEHVVVTRN | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 2053.0857 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3033 | QGPVNLLSDPEQGVEVTGQYEREK | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 2671.3089 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3034 | PGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 2723.382 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3035 | HRQGPVNLLSDPEQGVEVTGQYEREK | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 2964.469 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3036 | AISGGSIQIENGYFVHYFAPEGLTTMPK | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 3026.4848 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3037 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 3271.6349 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3038 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 3287.6298 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3257 | GPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1520 | MALDI-TOF | Stomach adenocarcinoma | NA | 21267442 |
| CancerPDF_ID4681 | DTDRFSSHVGGTLGQF | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4709 | DYQEGPPGVEI | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5041 | FSVMPGLKM | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5042 | FSVMPGLKMTM | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5043 | FSVMPGLKMTMDKTGL | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5044 | FSVMPGLKMTMDKTGLL | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5045 | FSVMPGLKMTMDKTGLLL | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5145 | GGTLGQFYQEV | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5206 | GLLFWDGRGEGLRL | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5407 | HYFAPEGLTTMPKNV | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5478 | IKILDDLSPRDQFNL | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5556 | IYEETRGVLKV | Histone H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5557 | IYEETRGVLKVF | Histone H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5558 | IYEETRGVLKVFLENVIRDAV | Histone H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5923 | LLLSDPDKVTIGL | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5924 | LLLSDPDKVTIGLL | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5931 | LLRDTDRFSSHVGGTLGQF | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6049 | LSDPDKVTIGL | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6050 | LSDPDKVTIGLLFWDGRGEGLRL | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6051 | LSDPEQGVEVTGQYEREK | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6052 | LSDPEQGVEVTGQYEREKAG | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6053 | LSDPEQGVEVTGQYEREKAGF | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6054 | LSDPEQGVEVTGQYEREKAGFSW | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6311 | NLLSDPEQGVEV | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6393 | PDPAVSRVMNM | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6400 | PGLKMTMDKTGLL | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6401 | PGLKMTMDKTGLLL | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6546 | QLGLPGPPDVPDHAAYHPF | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6672 | RGVLKVFLENVIRDAV | Histone H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6741 | SAENVNKARSFAAGIQALGGTNINDAMLMAV | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6812 | SFLETESTFMTNQLV | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6855 | SGLIYEETRGV | Histone H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6856 | SGLIYEETRGVLK | Histone H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6857 | SGLIYEETRGVLKV | Histone H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6858 | SGLIYEETRGVLKVF | Histone H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6859 | SGLIYEETRGVLKVFLENV | Histone H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7094 | SSHVGGTLGQFY | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7095 | SSHVGGTLGQFYQEV | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7166 | SVMPGLKMTMDKTGLL | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7215 | SWIEVTFKNPL | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7374 | TFEYPSNAVEEV | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7375 | TFEYPSNAVEEVTQNN | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7376 | TFEYPSNAVEEVTQNNFRLLFKGSEMVV | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7832 | VFLENVIRDAV | Histone H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8277 | YFAPEGLTTMPKN | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8311 | YLTIQQLLEQTV | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8564 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 3271.63 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8565 | PGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 2723.38 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8566 | GVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 2626.33 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8567 | SSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 2357.16 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8568 | QLGLPGPPDVPDHAAYHPFR | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 2183.09 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8569 | QLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 2026.99 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8570 | GLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1785.85 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8571 | GLPGPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1170.57 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8572 | GLPGPPDVPDH | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1099.53 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8573 | PGPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1000.46 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8574 | GPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 903.41 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8575 | GPPDVPDH | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 832.37 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8576 | NVHSGSTFFKYYLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 3155.62 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8577 | GSEMVVAGKLQDR | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1388.71 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8613 | SEMVVAGKLQ | Inter- trypsin inhibitor heavy chain H4 (ITIH4) precursor | Serum | 1061.09 | MALDI-TOF | Breast cancer | Upregulated in cancer as compare to normal control with fold change of 1.6 | 26705257 |
| CancerPDF_ID8614 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter- trypsin inhibitor heavy chain H4 (ITIH4) fragment | Serum | 3273.69 | MALDI-TOF | Breast cancer | Upregulated in cancer as compare to normal control with fold change of 1.7 | 26705257 |
| CancerPDF_ID8617 | NVHSAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter- trypsin inhibitor heavy chain H4 (ITIH4) fragment | Serum | 4280.55 | MALDI-TOF | Breast cancer | Upregulated in cancer as compare to normal control with fold change of 1.10 | 26705257 |
| CancerPDF_ID8774 | DRGPDVLTATVSGK | Isoform 1 of Inter-alpha-trypsin inhibitor heavy chain H4 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8876 | GKLQDRGPDVLTATVSGK | Isoform 1 of Inter-alpha-trypsin inhibitor heavy chain H4 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8910 | GSEMVVAGKLQDRGPDVLT | Isoform 1 of Inter-alpha-trypsin inhibitor heavy chain H4 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9001 | KLQDRGPDVLTATVSGK | Isoform 1 of Inter-alpha-trypsin inhibitor heavy chain H4 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9048 | LPGPPDVPDH | Isoform 1 of Inter-alpha-trypsin inhibitor heavy chain H4 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9049 | LPGPPDVPDHA | Isoform 1 of Inter-alpha-trypsin inhibitor heavy chain H4 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9055 | LQDRGPDVLTA | Isoform 1 of Inter-alpha-trypsin inhibitor heavy chain H4 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9133 | PAVSRVMN | Isoform 1 of Inter-alpha-trypsin inhibitor heavy chain H4 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9154 | QDRGPDVLTATVSGK | Isoform 1 of Inter-alpha-trypsin inhibitor heavy chain H4 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9198 | QVAEKPMEGES | Isoform 1 of Inter-alpha-trypsin inhibitor heavy chain H4 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9473 | GPPDVPDHAAYHPFR | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 1675.8 | MALDI-TOF | Colorectal cancer | Lower intensity in liver metastasis than control groups and an opposite trend in adenoma and CRC group. | 26379225 |
| CancerPDF_ID9487 | QLGLPGPPDVPDHAAYHPFR | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 2167.08 | MALDI-TOF | Colorectal cancer | Higher intensity in CRC groups vs controls. | 26379225 |
| CancerPDF_ID9798 | PGPPDVPDH | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 465.7 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9799 | PGVLSSRQL | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 478.77 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9800 | PGPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 501.23 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9801 | LPGPPDVPDH | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 522.25 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9802 | GLPGPPDVPDH | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 550.75 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9803 | LPGPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 557.77 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9804 | GSEMVVAGKLQ | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 567.79 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9805 | GLPGPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 586.27 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9806 | GLPGPPDVPDHAA | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 621.81 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9807 | GLPGPPDVPDHAAY | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 703.34 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9808 | GVLSSRQLGLPGPPD | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 746.88 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9809 | AVEEVTQNNFRLL | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 766.9 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9810 | PGVLSSRQLGLPGPPD | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 795.43 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9811 | PGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 808.85 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9812 | SRQLGLPGPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 552.62 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9813 | GVLSSRQLGLPGPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 671.34 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9814 | PGVLSSRQLGLPGPPDVPDHAA | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 727.39 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9815 | PGVLSSRQLGLPGPPDVPDHAAYHP | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 645.07 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9816 | PGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 681.83 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9817 | SEMVVAGKLQ | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 531.28 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9818 | GSEMVVAGKLQ | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 559.79 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9819 | IPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 410.23 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9820 | GSEMVVAGKLQDR | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 463.91 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9821 | GSEMVVAGKLQDR | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 469.24 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9938 | SRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | NA | 21124649 |
| CancerPDF_ID9939 | SSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21124649 |
| CancerPDF_ID9940 | GVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21124649 |
| CancerPDF_ID9941 | PGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | NA | 21124649 |
| CancerPDF_ID9942 | RPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | NA | 21124649 |
| CancerPDF_ID9943 | FRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | NA | 21124649 |
| CancerPDF_ID9944 | NFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21124649 |
| CancerPDF_ID9945 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21124649 |
| CancerPDF_ID9946 | SRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21137033 |
| CancerPDF_ID9947 | SSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21137033 |
| CancerPDF_ID9948 | GVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21137033 |
| CancerPDF_ID9949 | PGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21137033 |
| CancerPDF_ID9950 | RPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21137033 |
| CancerPDF_ID9951 | FRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21137033 |
| CancerPDF_ID9952 | NFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21137033 |
| CancerPDF_ID9953 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | NA | LC-MS | Breast cancer | Differentially expressed between cancer vs control | 21137033 |
| CancerPDF_ID9961 | RTERGRKM | Myosin-4 | Urine | 1033.5371 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10105 | VTGQYEREKAGF | Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | 1384.6775 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10157 | WGSPAASDDGRRTL | Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | 1488.7096 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10171 | RRLDYQEGPPGVE | Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | 1515.7416 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10226 | VEVTGQYEREKAGF | Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | 1612.7779 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10397 | VTFKNPLVWVHASPEHV | Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | 1960.0218 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10504 | HSATRERRLDYQEGPPGVE | Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | 2197.0218 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10552 | LSDPEQGVEVTGQYEREKAGF | Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | 2339.1062 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11055 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | ITIH4 | Serum | 3273 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Downregulated in ESCC patients vs control with mean intensity in cancer 221.86 and mean intensity in normal 764.46 | 26993605 |
| CancerPDF_ID11058 | NVHSGSTFFKYYLQGAKIPKPEAS | ITIH4 | Serum | 2669.1 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Upregulated in ESCC patients vs control with mean intensity in cancer 417.72 and mean intensity in normal 190.00 | 26993605 |
| CancerPDF_ID11059 | QLGLPGPPDVPDHAAYHPF | ITIH4 | Serum | 2026.8 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | "Upregulated in ESCC patients vs control with mean intensity in cancer as 2,730.99 and mean intensity in normal 1,290.54" | 26993605 |
| CancerPDF_ID11083 | NA | MYH4_HUMAN | Urine | 1934.197 | MALDI-TOF | Clear cell renal carcinoma | "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" | 26482227 |
| CancerPDF_ID11495 | GLYQKSAMK | Myosin-4 | Serum | 1024.5376 | LC-MS | Melanoma | "Present in 2 cancer samples out of 8 cancer samples. ,Present in 3 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID11546 | HAAYHPF | ITIH4 protein | Serum | NA | LC-MS | Melanoma | "Present in 6 cancer samples out of 8 cancer samples. ,Present in 3 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID11607 | HTEASFSPR | ITIH4 protein | Serum | NA | LC-MS | Melanoma | "Present in 3 cancer samples out of 8 cancer samples. ,Present in 3 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID11700 | KAKEPPFVRK | Zinc finger CCCH domain-containing protein 4 | Serum | NA | LC-MS | Melanoma | "Present in 3 cancer samples out of 8 cancer samples. ,Present in 3 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID11967 | NVHSAGAAGSRMN | Inter-alpha-trypsin inhibitor heavy chain H4 (Fragment) | Serum | 1270.5837 | LC-MS | Melanoma | "Present in 8 cancer samples out of 8 cancer samples. ,Present in 4 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID12173 | SEMVVAGKLQ | ITIH4 protein | Serum | 1060.5587 | LC-MS | Melanoma | "Present in 8 cancer samples out of 8 cancer samples. ,Present in 4 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID12664 | SEMVVAGKLQ | ITIH4 protein | Serum | NA | LC-MS | Melanoma | "Present in 8 cancer samples out of 8 cancer samples. ,Present in 4 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID13034 | VIRDAVTY | Histone H4 | Plasma | 936.516 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |
| CancerPDF_ID13359 | TVFPEELIIGR | Alcohol dehydrogenase 4 | Plasma | 1273.716 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |
| CancerPDF_ID13620 | NVIRDAVTY | Histone H4 | Plasma | 1050.558 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |