Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID2269 | MRMLVDLAKSR | Glucose-6-phosphate isomerase | Serum | 1334.71626 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID5505 | INIGIGGSDLGPLMV | Glucose-6-phosphate isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5554 | IWDINSFDQWGV | Glucose-6-phosphate isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6285 | NIGIGGSDLGPLMV | Glucose-6-phosphate isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6286 | NIGIGGSDLGPLMVTEALKPYSSGGPRVWYV | Glucose-6-phosphate isomerase | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |