Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID120 | KIRPFFPQQ | Fibrinogen beta chain | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID162 | NDNEEGFFSAR | Fibrinopeptide B | Serum | 1129.4849 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS | 19728888 |
| CancerPDF_ID843 | KREEAPSLRPAPPPISGGGYR | Fibrinogen beta chain | Plasma | 745.73 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID844 | KREEAPSLRPAPPPISGGGY | Fibrinogen beta chain | Plasma | 693.69 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID845 | REEAPSLRPAPPPISGGGYR | Fibrinogen beta chain | Plasma | 703.04 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID846 | REEAPSLRPAPPPISGGGY | Fibrinogen beta chain | Plasma | 651 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID847 | EEAPSLRPAPPPISGGGYR | Fibrinogen beta chain | Plasma | 651.03 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID848 | EEAPSLRPAPPPISGGGY | Fibrinogen beta chain | Plasma | 897.95 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID849 | EEAPSLRPAPPPISGGG | Fibrinogen beta chain | Plasma | 816.41 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID850 | EEAPSLRPAPPPISGG | Fibrinogen beta chain | Plasma | 787.91 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID851 | EEAPSLRPAPPPISG | Fibrinogen beta chain | Plasma | 759.39 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID852 | EEAPSLRPAPPPIS | Fibrinogen beta chain | Plasma | 730.88 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID853 | EAPSLRPAPPPISGGGYR | Fibrinogen beta chain | Plasma | 607.98 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID854 | EAPSLRPAPPPISGGGY | Fibrinogen beta chain | Plasma | 833.43 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID855 | EAPSLRPAPPPISGGG | Fibrinogen beta chain | Plasma | 751.89 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID856 | SLRPAPPPISGGGY | Fibrinogen beta chain | Plasma | 684.86 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID857 | SLRPAPPPISGGG | Fibrinogen beta chain | Plasma | 603.33 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID858 | PAPPPISGGGYR | Fibrinogen beta chain | Plasma | 584.81 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID859 | PAPPPISGGGY | Fibrinogen beta chain | Plasma | 506.75 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID860 | QGVNDNEEGFFSAR | Fibrinogen beta chain | Plasma | 785.34 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID861 | VNDNEEGFFSAR | Fibrinogen beta chain | Plasma | 692.81 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID862 | VNDNEEGFFSA | Fibrinogen beta chain | Plasma | 614.75 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID863 | NDNEEGFFSAR | Fibrinogen beta chain | Plasma | 643.27 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID864 | DNEEGFFSAR | Fibrinogen beta chain | Plasma | 586.25 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID2740 | AKAAATQK | Fibrinogen beta chain | Plasma | 787.4552 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2741 | RPFFPQ | Fibrinogen beta chain | Plasma | 790.4126 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2742 | KWDPYK | Fibrinogen beta chain | Plasma | 835.4228 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2743 | DLWQKR | Fibrinogen beta chain | Plasma | 844.4555 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2744 | GSWYSMR | Fibrinogen beta chain | Plasma | 885.3803 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2745 | RPAKAAATQ | Fibrinogen beta chain | Plasma | 912.5141 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2746 | KREEAPSL | Fibrinogen beta chain | Plasma | 928.4978 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2747 | REEAPSLR | Fibrinogen beta chain | Plasma | 956.5039 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2748 | QDGSVDFGR | Fibrinogen beta chain | Plasma | 979.4359 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2749 | PAPPPISGGGY | Fibrinogen beta chain | Plasma | 1011.5026 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2750 | YQISVNKY | Fibrinogen beta chain | Plasma | 1013.5182 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2751 | IRPFFPQQ | Fibrinogen beta chain | Plasma | 1031.5552 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2752 | RPAKAAATQK | Fibrinogen beta chain | Plasma | 1040.6091 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2753 | QDGSVDFGRK | Fibrinogen beta chain | Plasma | 1107.5309 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2754 | ARPAKAAATQK | Fibrinogen beta chain | Plasma | 1111.6462 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2755 | PAPPPISGGGYR | Fibrinogen beta chain | Plasma | 1167.6037 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2756 | YQISVNKYR | Fibrinogen beta chain | Plasma | 1169.6193 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2757 | EDGGGWWYNR | Fibrinogen beta chain | Plasma | 1238.5105 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2758 | NDNEEGFFSAR | Fibrinogen beta chain | Plasma | 1284.5371 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2759 | QGFGNVATNTDGK | Fibrinogen beta chain | Plasma | 1307.6106 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2760 | SVNKYRGTAGNAL | Fibrinogen beta chain | Plasma | 1349.7052 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2761 | VNDNEEGFFSAR | Fibrinogen beta chain | Plasma | 1383.6055 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2762 | HGTDDGVVWMNW | Fibrinogen beta chain | Plasma | 1415.5928 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2763 | HYGGFTVQNEANK | Fibrinogen beta chain | Plasma | 1463.6793 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2764 | AHYGGFTVQNEANK | Fibrinogen beta chain | Plasma | 1534.7164 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2765 | HGTDDGVVWMNWK | Fibrinogen beta chain | Plasma | 1543.6878 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2766 | VKAHYGGFTVQNEAN | Fibrinogen beta chain | Plasma | 1633.7849 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2767 | QDGSVDFGRKWDPY | Fibrinogen beta chain | Plasma | 1668.7532 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2768 | MGPTELLIEMEDWK | Fibrinogen beta chain | Plasma | 1690.7946 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2769 | MGPTELLIEMEDWK | Fibrinogen beta chain | Plasma | 1706.7895 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2770 | VKAHYGGFTVQNEANK | Fibrinogen beta chain | Plasma | 1761.8798 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2771 | DNENVVNEYSSELEK | Fibrinogen beta chain | Plasma | 1767.7799 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2772 | REEAPSLRPAPPPISGGG | Fibrinogen beta chain | Plasma | 1786.9326 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2773 | TMTIHNGMFFSTYDR | Fibrinogen beta chain | Plasma | 1819.8022 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2774 | KREEAPSLRPAPPPISGGG | Fibrinogen beta chain | Plasma | 1915.0276 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2775 | GDKVKAHYGGFTVQNEAN | Fibrinogen beta chain | Plasma | 1933.9282 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2776 | REEAPSLRPAPPPISGGGY | Fibrinogen beta chain | Plasma | 1949.9959 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2777 | DNEEGFFSARGHRPLDK | Fibrinogen beta chain | Plasma | 1973.9344 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2778 | MGPTELLIEMEDWKGDK | Fibrinogen beta chain | Plasma | 1990.938 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2779 | MGPTELLIEMEDWKGDK | Fibrinogen beta chain | Plasma | 2006.9329 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2780 | GDKVKAHYGGFTVQNEANK | Fibrinogen beta chain | Plasma | 2062.0232 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2781 | KREEAPSLRPAPPPISGGGY | Fibrinogen beta chain | Plasma | 2078.0909 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2782 | NDNEEGFFSARGHRPLDK | Fibrinogen beta chain | Plasma | 2087.9773 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2783 | MGPTELLIEMEDWKGDKV | Fibrinogen beta chain | Plasma | 2090.0064 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2784 | GGETSEMYLIQPDSSVKPY | Fibrinogen beta chain | Plasma | 2099.9721 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2785 | MGPTELLIEMEDWKGDKV | Fibrinogen beta chain | Plasma | 2106.0013 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2786 | REEAPSLRPAPPPISGGGYR | Fibrinogen beta chain | Plasma | 2106.097 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2787 | QVKDNENVVNEYSSELEK | Fibrinogen beta chain | Plasma | 2123.0019 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2788 | VNDNEEGFFSARGHRPLDK | Fibrinogen beta chain | Plasma | 2187.0457 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2789 | MGPTELLIEMEDWKGDKVK | Fibrinogen beta chain | Plasma | 2218.1014 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2790 | MGPTELLIEMEDWKGDKVK | Fibrinogen beta chain | Plasma | 2234.0963 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2791 | KREEAPSLRPAPPPISGGGYR | Fibrinogen beta chain | Plasma | 2234.192 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2792 | AHYGGFTVQNEANKYQISVN | Fibrinogen beta chain | Plasma | 2239.0658 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2793 | GGETSEMYLIQPDSSVKPYR | Fibrinogen beta chain | Plasma | 2256.0732 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2794 | AHYGGFTVQNEANKYQISVNK | Fibrinogen beta chain | Plasma | 2367.1608 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2795 | KGGETSEMYLIQPDSSVKPYR | Fibrinogen beta chain | Plasma | 2384.1682 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2796 | VKAHYGGFTVQNEANKYQISVN | Fibrinogen beta chain | Plasma | 2466.2292 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2797 | AHYGGFTVQNEANKYQISVNKY | Fibrinogen beta chain | Plasma | 2530.2241 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2798 | VKAHYGGFTVQNEANKYQISVNK | Fibrinogen beta chain | Plasma | 2594.3241 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2799 | VKAHYGGFTVQNEANKYQISVNKY | Fibrinogen beta chain | Plasma | 2757.3875 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2800 | GHRPLDKKREEAPSLRPAPPPISGGGY | Fibrinogen beta chain | Plasma | 2881.5311 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2801 | GDKVKAHYGGFTVQNEANKYQISVNK | Fibrinogen beta chain | Plasma | 2894.4675 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2802 | GHRPLDKKREEAPSLRPAPPPISGGGYR | Fibrinogen beta chain | Plasma | 3037.6322 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2803 | TMTIHNGMFFSTYDRDNDGWLTSDPR | Fibrinogen beta chain | Plasma | 3076.3444 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2804 | DNENVVNEYSSELEKHQLYIDETVNSNIPTNLRVL | Fibrinogen beta chain | Plasma | 4087.9974 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3464 | EEAPSLRPAPPPISGGGY | Fibrinogen beta chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3646 | EEAPSLRPAPPPISGGGY | Fibrinogen beta chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID4029 | ASQLMGENRTMTIHNGMFFST | Fibrinogen beta chain | Human milk | NA | MALDI-TOF | Normal | Downregulated 3 fold in Pre-term case as compare to normal | 23891694 |
| CancerPDF_ID6034 | LRPAPPPISGGGY | Fibrinogen beta chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7055 | SQLTRMGPTELL | Fibrinogen beta chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID9488 | QGVNDNEEGFFSARGHRPLD | Fibrinogen beta chain | Plasma | 2228.03 | MALDI-TOF | Colorectal cancer | "Similar median ion intensity between controls and liver metastasis, and higher median ion intensity for adenoma and CRC groups." | 26379225 |
| CancerPDF_ID9489 | KREEAPSLRPAPPPISGGGYR | Fibrinogen beta chain | Plasma | 2235.21 | MALDI-TOF | Colorectal cancer | "Similar median ion intensity between controls and liver metastasis, and higher median ion intensity for adenoma and CRC groups." | 26379225 |
| CancerPDF_ID9490 | QGVNDNEEGFFSARGHRPLDK | Fibrinogen beta chain | Plasma | 2356.13 | MALDI-TOF | Colorectal cancer | "Similar median ion intensity between controls and liver metastasis, and higher median ion intensity for adenoma and CRC groups." | 26379225 |
| CancerPDF_ID9764 | EEAPSLRPAPPPISGGGY | Fibrinogen beta chain | Serum | 897.92 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9765 | NEEGFFSA | Fibrinogen beta chain | Serum | 450.68 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9766 | NDNEEGFFSA | Fibrinogen beta chain | Serum | 565.21 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID10010 | KIRPFFPQQ | Fibrinogen beta chain | Urine | 1160.6606 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10233 | EEAPSLRPAPPPISGGG | Fibrinogen beta chain | Urine | 1631.8263 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10319 | EEAPSLRPAPPPISGGGY | Fibrinogen beta chain | Urine | 1794.8781 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10490 | DKKREEAPSLRPAPPPISGGG | Fibrinogen beta chain | Urine | 2159.0898 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10497 | YSMRKMSMKIRPFFPQQ | Fibrinogen beta chain | Urine | 2175.0927 | MALDI-TOF | Muscle-invasive bladder cancer | Upregulated in cancer vs normal | 21805675 |
| CancerPDF_ID10517 | KREEAPSLRPAPPPISGGGYR | Fibrinogen beta chain | Urine | 2235.2016 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10543 | DKKREEAPSLRPAPPPISGGGY | Fibrinogen beta chain | Urine | 2322.2307 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10678 | GHRPLDKKREEAPSLRPAPPPISGGGYR | Fibrinogen beta chain | Urine | 3038.6362 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11163 | AANPNGRYY | Fibrinogen beta chain | Serum | 1024.4726 | LC-MS | Melanoma | "Present in 2 cancer samples out of 8 cancer samples. ,Present in 0 healthy samples out of 4 healthy samples." | 26992070 |