Browse result page of CancerPDF Database

Please click on CancerPDF_ID for detailed information about peptide.

CancerPDF_IDPeptide seqProtein NameFluidMass/ZProfiling TechniqueCancer Type Expression RegulationPUBMED ID
CancerPDF_ID8622 NANASerum759MS/MSEsophageal squamous cell carcinoma (ESCC) Diffrential expressed between cancer and normal 23586861
CancerPDF_ID8623 NANASerum786MS/MSEsophageal squamous cell carcinoma (ESCC) Diffrential expressed between cancer and normal 23586861
CancerPDF_ID8624 NANASerum1866MS/MSEsophageal squamous cell carcinoma (ESCC) Diffrential expressed between cancer and normal 23586861
CancerPDF_ID8625 NANASerum3316MS/MSEsophageal squamous cell carcinoma (ESCC) Diffrential expressed between cancer and normal 23586861
CancerPDF_ID8626 NANASerum6634MS/MSEsophageal squamous cell carcinoma (ESCC) Diffrential expressed between cancer and normal 23586861
CancerPDF_ID11051 NRIPESGGDNSVFDIFELTGAARKGSGRThrombospondin-1Serum2950.6MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Upregulated in patients vs normal with mean intensity 84.95 in control and 666.08 in cancer 26993605
CancerPDF_ID11052 SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAKSRPVFibrinogen alpha chainSerum5900MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Upregulated in patients vs normal with mean intensity 100.55 in normal and 831.12 in cancer 26993605
CancerPDF_ID11053 MGVVSLGSPSGEVSHPRKTAlpha2-HS glycoproteinSerum1925.5MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Downregulated in patients vs normal with mean intensity in cancer 149.51 and mean intensity in normal as 590.32 26993605
CancerPDF_ID11054 SSYSKQFTSSTSYNRGDSTFibrinogen alpha chainSerum2102.7MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Upregulated in ESCC patients vs control with mean intensity in cancer as 532.28 and mean intensity in control as 266.24 26993605
CancerPDF_ID11055 MNFRPGVLSSRQLGLPGPPDVPDHAAYHPFITIH4Serum3273MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Downregulated in ESCC patients vs control with mean intensity in cancer 221.86 and mean intensity in normal 764.46 26993605
CancerPDF_ID11056 SYKMADEAGSEADHEGTHSTKRGHAKSRPVFibrinogen alpha chainSerum3239.9MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Upregulated in ESCC patients vs control with mean intensity in cancer as 831.12 and mean intensity in control as 100.55 26993605
CancerPDF_ID11057 LTKKFSRHHGPTITAKLAMBPSerum1935.9MALDI-TOFEsophageal squamous cell carcinoma (ESCC) "Downregulated in ESCC patients vs control with mean intensity in cancer 1018.23 and mean intensity in normal 2,456.36in normal" 26993605
CancerPDF_ID11058 NVHSGSTFFKYYLQGAKIPKPEASITIH4Serum2669.1MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Upregulated in ESCC patients vs control with mean intensity in cancer 417.72 and mean intensity in normal 190.00 26993605
CancerPDF_ID11059 QLGLPGPPDVPDHAAYHPFITIH4Serum2026.8MALDI-TOFEsophageal squamous cell carcinoma (ESCC) "Upregulated in ESCC patients vs control with mean intensity in cancer as 2,730.99 and mean intensity in normal 1,290.54" 26993605
CancerPDF_ID11060 CSRDNTLKVIDLRisoform CRA_bSerum1532.1MALDI-TOFEsophageal squamous cell carcinoma (ESCC) "Upregulated in ESCC patients vs control with mean intensity in cancer as 1,022.00 and mean intensity in normal as 527.84" 26993605
CancerPDF_ID11061 NANASerum5924.6MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Upregulated in ESCC patients vs control with mean intensity in cancer as 425.63 and mean intensity in normal as 50.61 26993605
CancerPDF_ID11062 NANASerum5910MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Upregulated in ESCC patients vs control with mean intensity in cancer as 739.57 and mean intensity in normal as 87.40 26993605
CancerPDF_ID11063 NANASerum5882.1MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Upregulated in ESCC patients vs control with mean intensity in cancer as 681.97 and mean intensity in normal as 114.65 26993605
CancerPDF_ID11064 NANASerum4209.6MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Upregulated in ESCC patients vs control with mean intensity in cancer as 1772.59 and mean intensity in normal as 696.17 26993605
CancerPDF_ID11065 NANASerum4199.6MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Upregulated in ESCC patients vs control with mean intensity in cancer as 1767.14 and mean intensity in normal as 867.09 26993605
CancerPDF_ID11066 NANASerum4225.6MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Upregulated in ESCC patients vs control with mean intensity in cancer as 526.85 and mean intensity in normal as224.98 26993605
CancerPDF_ID11067 NANASerum3883.6MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Upregulated in ESCC patients vs control 26993605
CancerPDF_ID11068 NANASerum3249.2MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Upregulated in ESCC patients vs control 26993605
CancerPDF_ID11069 NANASerum4086.1MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Upregulated in ESCC patients vs control 26993605
CancerPDF_ID11070 NANASerum3264.9MALDI-TOFEsophageal squamous cell carcinoma (ESCC) Downregulated in ESCC patients vs control with mean intensity in cancer and mean intensity in normal 26993605