Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID958 | NA | NA | Serum | 5907.39 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID959 | NA | NA | Serum | 797.46 | MALDI-TOF | Colorectal cancer | Downregulated in cancer vs normal | 23091368 |
| CancerPDF_ID960 | NA | NA | Serum | 824.78 | MALDI-TOF | Colorectal cancer | Downregulated in cancer vs normal | 23091368 |
| CancerPDF_ID961 | NA | NA | Serum | 4210.93 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID962 | NA | NA | Serum | 9300.76 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID963 | NA | NA | Serum | 2660.82 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID964 | NA | NA | Serum | 7772.38 | MALDI-TOF | Colorectal cancer | Upregulated and considered as candidate biomarker | 23091368 |
| CancerPDF_ID965 | NA | NA | Serum | 849.66 | MALDI-TOF | Colorectal cancer | Downregulated in cancer vs normal | 23091368 |
| CancerPDF_ID966 | NA | NA | Serum | 1617.78 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID967 | NA | NA | Serum | 741.43 | MALDI-TOF | Colorectal cancer | Downregulated and considered as candidate biomarker | 23091368 |
| CancerPDF_ID968 | NA | NA | Serum | 4645.43 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID969 | NA | NA | Serum | 4091.82 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID970 | NA | NA | Serum | 682.37 | MALDI-TOF | Colorectal cancer | Downregulated in cancer vs normal | 23091368 |
| CancerPDF_ID971 | NA | NA | Serum | 909.82 | MALDI-TOF | Colorectal cancer | Downregulated in cancer vs normal | 23091368 |
| CancerPDF_ID972 | NA | NA | Serum | 1466.77 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID973 | NA | NA | Serum | 720.62 | MALDI-TOF | Colorectal cancer | Downregulated in cancer vs normal | 23091368 |
| CancerPDF_ID974 | NA | NA | Serum | 1546.58 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID975 | NA | NA | Serum | 3241.4 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID976 | NA | NA | Serum | 5338.71 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID977 | NA | NA | Serum | 895.59 | MALDI-TOF | Colorectal cancer | Downregulated in cancer vs normal | 23091368 |
| CancerPDF_ID978 | NA | NA | Serum | 2952.94 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID979 | NA | NA | Serum | 3952.53 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID980 | NA | NA | Serum | 4965.34 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID981 | NA | NA | Serum | 4054.81 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID982 | NA | NA | Serum | 2863.08 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID983 | NA | NA | Serum | 3263.36 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID984 | NA | NA | Serum | 3883.56 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID985 | NA | NA | Serum | 1866.35 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID986 | NA | NA | Serum | 1520.21 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID987 | NA | NA | Serum | 1450.62 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID988 | NA | NA | Serum | 4268.26 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID989 | NA | NA | Serum | 4123.72 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID990 | NA | NA | Serum | 5868.38 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID991 | NA | NA | Serum | 3192.38 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID992 | NA | NA | Serum | 2884.13 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID993 | NA | NA | Serum | 4073.6 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID994 | NA | NA | Serum | 2932.84 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID995 | NA | NA | Serum | 2105.88 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID996 | NA | NA | Serum | 4169.7 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID997 | NA | NA | Serum | 2900.31 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID998 | NA | NA | Serum | 6635.24 | MALDI-TOF | Colorectal cancer | Downregulated in cancer vs normal | 23091368 |
| CancerPDF_ID999 | NA | NA | Serum | 2769.91 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1000 | NA | NA | Serum | 1540.23 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1001 | NA | NA | Serum | 3935.5 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1002 | NA | NA | Serum | 1779.25 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1003 | NA | NA | Serum | 2644.78 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1004 | NA | NA | Serum | 1213.46 | MALDI-TOF | Colorectal cancer | Downregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1005 | NA | NA | Serum | 5755.96 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1006 | NA | NA | Serum | 4155.14 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1007 | NA | NA | Serum | 5636.48 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1008 | NA | NA | Serum | 2723.35 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1009 | NA | NA | Serum | 1207.42 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1010 | NA | NA | Serum | 4248.84 | MALDI-TOF | Colorectal cancer | Downregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1011 | NA | NA | Serum | 1351 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1012 | NA | NA | Serum | 3316.26 | MALDI-TOF | Colorectal cancer | Downregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1013 | NA | NA | Serum | 2545.55 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1014 | NA | NA | Serum | 2877.97 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1015 | NA | NA | Serum | 4110.58 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1016 | NA | NA | Serum | 5066.24 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1017 | NA | NA | Serum | 4676.49 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1018 | NA | NA | Serum | 2046.31 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1206 | LAEGGGVR | Fibrinogen alpha | Serum | 757.40825 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1207 | DFLAEGGGV | Fibrinogen alpha | Serum | 863.4025 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1208 | FLAEGGGVR | Fibrinogen alpha | Serum | 904.47667 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1209 | DFLAEGGGVR | Fibrinogen alpha | Serum | 1019.50361 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1210 | EGDFLAEGGGV | Fibrinogen alpha | Serum | 1049.46655 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1211 | DSTFESKSY | Fibrinogen alpha | Serum | 1062.45057 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1212 | GDFLAEGGGVR | Fibrinogen alpha | Serum | 1076.52507 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1213 | GEGDFLAEGGGV | Fibrinogen alpha | Serum | 1106.48802 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1214 | GDSTFESKSY | Fibrinogen alpha | Serum | 1119.47203 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1215 | SGEGDFLAEGGGV | Fibrinogen alpha | Serum | 1193.52005 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1216 | SGEGDFLAEGGGVR | Fibrinogen alpha | Serum | 1349.62116 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1217 | DSGEGDFLAEGGGVR | Fibrinogen alpha | Serum | 1464.6481 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1218 | ADSGEGDFLAEGGGVR | Fibrinogen alpha | Serum | 1535.68521 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1219 | TGKEKVTSGSTTTTR | Fibrinogen alpha | Serum | 1552.80566 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1220 | AGSEADHEGTHSTKR | Fibrinogen alpha | Serum | 1581.71316 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1221 | AGSEADHEGTHSTKRG | Fibrinogen alpha | Serum | 1638.73462 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1222 | NRGDSTFESKSYKMA | Fibrinogen alpha | Serum | 1719.78863 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1223 | SSYSKQFTSSTSYNR | Fibrinogen alpha | Serum | 1741.79074 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1224 | MADEAGSEADHEGTHST | Fibrinogen alpha | Serum | 1743.66422 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1225 | MADEAGSEADHEGTHST | Fibrinogen alpha | Serum | 1759.65914 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1226 | GSEADHEGTHSTKRGHA | Fibrinogen alpha | Serum | 1775.79354 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1227 | MADEAGSEADHEGTHSTKR | Fibrinogen alpha | Serum | 2027.86029 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1228 | EGDFLAEGGGVR | Fibrinogen alpha | Serum | 1205.56767 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1229 | GDSTFESKSYK | Fibrinogen alpha | Serum | 1247.567 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1230 | SKQFTSSTSYN | Fibrinogen alpha | Serum | 1248.56225 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1231 | GEGDFLAEGGGVR | Fibrinogen alpha | Serum | 1262.58913 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1232 | DSGEGDFLAEGGGV | Fibrinogen alpha | Serum | 1308.54699 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1233 | ADSGEGDFLAEGGGV | Fibrinogen alpha | Serum | 1379.5841 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1234 | NRGDSTFESKSY | Fibrinogen alpha | Serum | 1389.61607 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1235 | TGKEKVTSGSTTTT | Fibrinogen alpha | Serum | 1396.70455 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1236 | FTSSTSYNRGDST | Fibrinogen alpha | Serum | 1421.6059 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1237 | SSYSKQFTSSTSY | Fibrinogen alpha | Serum | 1471.6467 | LC-MS | Colorectal cancer | 0.898 | 21136997 |
| CancerPDF_ID1238 | DEAGSEADHEGTHST | Fibrinogen alpha | Serum | 1541.58662 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1239 | SSSYSKQFTSSTSY | Fibrinogen alpha | Serum | 1558.67873 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1240 | SSYSKQFTSSTSYN | Fibrinogen alpha | Serum | 1585.68963 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1241 | ADEAGSEADHEGTHST | Fibrinogen alpha | Serum | 1612.62374 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1242 | DEAGSEADHEGTHSTK | Fibrinogen alpha | Serum | 1669.68159 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1243 | DEAGSEADHEGTHSTKR | Fibrinogen alpha | Serum | 1825.7827 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1244 | AGSEADHEGTHSTKRGHA | Fibrinogen alpha | Serum | 1846.83065 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1245 | MADEAGSEADHEGTHSTK | Fibrinogen alpha | Serum | 1871.75918 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1246 | DEAGSEADHEGTHSTKRG | Fibrinogen alpha | Serum | 1882.80416 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1247 | DEAGSEADHEGTHSTKRGHA | Fibrinogen alpha | Serum | 2090.90019 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1248 | SYKMADEAGSEADHEGTHST | Fibrinogen alpha | Serum | 2121.85454 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1249 | SYKMADEAGSEADHEGTHST | Fibrinogen alpha | Serum | 2137.84946 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1250 | ADEAGSEADHEGTHSTKRGHA | Fibrinogen alpha | Serum | 2161.9373 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1251 | FTSSTSYNRGDSTFESKSY | Fibrinogen alpha | Serum | 2162.93926 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1252 | SSSYSKQFTSSTSYNRGDST | Fibrinogen alpha | Serum | 2188.95088 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1253 | SYKMADEAGSEADHEGTHSTK | Fibrinogen alpha | Serum | 2249.9495 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1254 | MADEAGSEADHEGTHSTKRGHA | Fibrinogen alpha | Serum | 2292.97778 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1255 | MADEAGSEADHEGTHSTKRGHA | Fibrinogen alpha | Serum | 2308.9727 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1256 | SSSYSKQFTSSTSYNRGDSTF | Fibrinogen alpha | Serum | 2336.0193 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1257 | TSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha | Serum | 2346.0434 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1258 | AGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha | Serum | 2414.17993 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1259 | DEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha | Serum | 2658.24947 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1260 | SYKMADEAGSEADHEGTHSTKRGHA | Fibrinogen alpha | Serum | 2671.1681 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1261 | SSYSKQFTSSTSYNRGDSTFESKSY | Fibrinogen alpha | Serum | 2843.25221 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1262 | YSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha | Serum | 2928.3236 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1263 | SSSYSKQFTSSTSYNRGDSTFESKSY | Fibrinogen alpha | Serum | 2930.28424 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1264 | YSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha | Serum | 2999.36072 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1265 | SSSYSKQFTSSTSYNRGDSTFESKSYK | Fibrinogen alpha | Serum | 3058.3792 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1266 | SYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha | Serum | 3086.39274 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1267 | GKSSSYSKQFTSSTSYNRGDSTFESKSY | Fibrinogen alpha | Serum | 3115.40067 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1268 | SSSYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha | Serum | 3189.41969 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1269 | SYSKQFTSSTSYN | Fibrinogen alpha | Serum | 1498.6576 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1270 | QFTSSTSYNRGDST | Fibrinogen alpha | Serum | 1549.66448 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1271 | SSSYSKQFTSSTSYN | Fibrinogen alpha | Serum | 1672.72166 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1272 | FTSSTSYNRGDSTFES | Fibrinogen alpha | Serum | 1784.74894 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1273 | SSSYSKQFTSSTSYNR | Fibrinogen alpha | Serum | 1828.82277 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1274 | SSYSKQFTSSTSYNRGDST | Fibrinogen alpha | Serum | 2101.91886 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1275 | SSTSYNRGDSTFESKSYKMA | Fibrinogen alpha | Serum | 2244.99573 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1276 | SYSKQFTSSTSYNRGDSTFES | Fibrinogen alpha | Serum | 2378.02986 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1277 | FTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha | Serum | 2422.0747 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1278 | SSYSKQFTSSTSYNRGDSTFES | Fibrinogen alpha | Serum | 2465.06189 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1279 | FTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha | Serum | 2493.11182 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1280 | KSYKMADEAGSEADHEGTHSTKR | Fibrinogen alpha | Serum | 2534.14558 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1281 | SSSYSKQFTSSTSYNRGDSTFES | Fibrinogen alpha | Serum | 2552.09392 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1282 | SSSYSKQFTSSTSYNRGDSTFESK | Fibrinogen alpha | Serum | 2680.18888 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1283 | SSSYSKQFTSSTSYNRGDSTFESKS | Fibrinogen alpha | Serum | 2767.22091 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1284 | SSSYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha | Serum | 3205.4146 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1285 | SSSYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha | Serum | 3260.4568 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1286 | SSSYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha | Serum | 3260.4568 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1287 | GKSSSYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha | Serum | 3374.53611 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1288 | GKSSSYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha | Serum | 3445.57323 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1289 | ELERPGGNEITR | Fibrinogen alpha | Serum | 1369.69499 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1290 | EKVTSGSTTTT | Fibrinogen alpha | Serum | 1110.54045 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1291 | EKVTSGSTTTTR | Fibrinogen alpha | Serum | 1266.64156 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1292 | AGSEADHEGTHST | Fibrinogen alpha | Serum | 1297.51709 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1293 | DEAAFFDTASTGK | Fibrinogen alpha | Serum | 1358.59903 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1294 | DEAGSEADHEGTHS | Fibrinogen alpha | Serum | 1440.53894 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1295 | KMADEAGSEADHEGTHST | Fibrinogen alpha | Serum | 1871.75918 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1296 | AWTADSGEGDFLAEGGGVR | Fibrinogen alpha | Serum | 1893.84932 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1297 | TSSTSYNRGDSTFESKSY | Fibrinogen alpha | Serum | 2015.87084 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1298 | SYKMADEAGSEADHEGTHSTKR | Fibrinogen alpha | Serum | 2406.05061 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1299 | GKSSSYSKQFTSSTSYNRGDSTFESK | Fibrinogen alpha | Serum | 2865.30531 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1300 | GDSTFESKSYKMADEAGSEADHEGTHST | Fibrinogen alpha | Serum | 2973.22065 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1301 | SYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha | Serum | 3015.35563 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1302 | SSYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha | Serum | 3102.38766 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1303 | TSSTSYNRGDSTFES | Fibrinogen alpha | Serum | 1637.68052 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1304 | GGSTSYGTGSETESPRN | Fibrinogen alpha | Serum | 1685.71289 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1305 | ALTDMPQMRMELERPGGNEIT | Fibrinogen alpha | Serum | 2388.12359 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1306 | SYSKQFTSSTSYNRGDSTFESKSYK | Fibrinogen alpha | Serum | 2884.31515 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1307 | SSYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha | Serum | 3173.42477 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1308 | SSSYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha | Serum | 3276.45172 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1309 | QFTSSTSYNRGDSTFES | Fibrinogen alpha | Serum | 1912.80751 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1310 | SSSYSKQFTS | Fibrinogen alpha | Serum | 1120.50367 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1311 | RGDSTFESKSY | Fibrinogen alpha | Serum | 1275.57314 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1312 | SSSYSKQFTSSTS | Fibrinogen alpha | Serum | 1395.6154 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1313 | NRGDSTFESKSYK | Fibrinogen alpha | Serum | 1517.71104 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1314 | STSYNRGDSTFESKS | Fibrinogen alpha | Serum | 1664.72781 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1315 | HRHPDEAAFFDTASTGK | Fibrinogen alpha | Serum | 1885.87072 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1316 | MADEAGSEADHEGTHSTK | Fibrinogen alpha | Serum | 1887.7541 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1317 | REYHTEKLVTSKGDKELR | Fibrinogen alpha | Serum | 2188.16003 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1318 | QFTSSTSYNRGDSTFESKSY | Fibrinogen alpha | Serum | 2290.99783 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1319 | YSKQFTSSTSYNRGDSTFESKS | Fibrinogen alpha | Serum | 2506.12483 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1320 | SYKMADEAGSEADHEGTHSTKRGHA | Fibrinogen alpha | Serum | 2687.16302 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1321 | STSYNRGDSTFES | Fibrinogen alpha | Serum | 1449.60082 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1322 | STSYNRGDSTFESKSY | Fibrinogen alpha | Serum | 1827.79114 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1323 | STSYNRGDSTFESKSYKMA | Fibrinogen alpha | Serum | 2157.9637 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1324 | TSSTSYNRGDSTFESKSYKM | Fibrinogen alpha | Serum | 2275.00629 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1325 | GKSSSYSKQFTSSTSYNRGDSTFESKS | Fibrinogen alpha | Serum | 2952.33734 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1326 | GKSSSYSKQFTSSTSYNRGDSTFES | Fibrinogen alpha | Serum | 2737.21035 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1327 | NRGDSTFESKSYKM | Fibrinogen alpha | Serum | 1648.75152 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1328 | MADEAGSEADHEGTHSTKR | Fibrinogen alpha | Serum | 2043.85521 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1329 | FTSSTSYNRGD | Fibrinogen alpha | Serum | 1233.52619 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1330 | SSTSYNRGDSTFESKSY | Fibrinogen alpha | Serum | 1914.82316 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1331 | SYSKQFTSSTSYNRGDST | Fibrinogen alpha | Serum | 2014.88683 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1332 | STSYNRGDSTFESKSYKM | Fibrinogen alpha | Serum | 2086.92658 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1333 | QFTSSTSYNRGDSTFESKS | Fibrinogen alpha | Serum | 2127.93451 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1334 | YSKQFTSSTSYN | Fibrinogen alpha | Serum | 1411.62557 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1335 | SSTSYNRGDSTFES | Fibrinogen alpha | Serum | 1536.63284 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1336 | GGSTSYGTGSETESPR | Fibrinogen alpha | Serum | 1571.66996 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1337 | TADSGEGDFLAEGGGVR | Fibrinogen alpha | Serum | 1636.73289 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1338 | GGSTSYGTGSETESPRNPSSAGSWNSGSSGPGSTGNR | Fibrinogen alpha | Serum | 3516.501 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1339 | KQFTSSTSYN | Fibrinogen alpha | Serum | 1161.53022 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1340 | ADEAGSEADHEGTHSTK | Fibrinogen alpha | Serum | 1740.7187 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1341 | ADEAGSEADHEGTHSTKR | Fibrinogen alpha | Serum | 1896.81981 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1342 | SYSKQFTSSTSYNRGDSTFESKSY | Fibrinogen alpha | Serum | 2756.22018 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1343 | SKQFTSSTSYNRGDST | Fibrinogen alpha | Serum | 1764.79147 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1344 | REYHTEKLVTSKGDKEL | Fibrinogen alpha | Serum | 2032.05892 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1345 | AGSEADHEGTHSTK | Fibrinogen alpha | Serum | 1425.61205 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1346 | SSYSKQFTSSTSYNRGDSTF | Fibrinogen alpha | Serum | 2248.98727 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1347 | GSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha | Serum | 2343.14282 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1348 | SYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha | Serum | 3238.51738 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1349 | GKSSSYSKQFTSSTSYNRGDSTFESKSYK | Fibrinogen alpha | Serum | 3243.49563 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1350 | GKSSSYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha | Serum | 3461.56814 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1351 | SSSYSKQFTSST | Fibrinogen alpha | Serum | 1308.58338 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1352 | GHAKSRPV | Fibrinogen alpha | Serum | 850.47733 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1353 | DFLAEGGG | Fibrinogen alpha | Serum | 764.33408 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1354 | LAEDVRGN | Apolipoprotein A-IV | Serum | 872.43519 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1355 | ASAEELRQ | Apolipoprotein A-IV | Serum | 902.44576 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1356 | ISASAEELR | Apolipoprotein A-IV | Serum | 974.50327 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1357 | LAPLAEDVR | Apolipoprotein A-IV | Serum | 982.54475 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1358 | LAEDVRGNL | Apolipoprotein A-IV | Serum | 985.51926 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1359 | SASAEELRQ | Apolipoprotein A-IV | Serum | 989.47779 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1360 | APLAEDVRGN | Apolipoprotein A-IV | Serum | 1040.52507 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1361 | IDQNVEELK | Apolipoprotein A-IV | Serum | 1086.5557 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1362 | ISASAEELRQ | Apolipoprotein A-IV | Serum | 1102.56185 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1363 | LAPLAEDVRGN | Apolipoprotein A-IV | Serum | 1153.60914 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1364 | QVNTQAEQLR | Apolipoprotein A-IV | Serum | 1185.6102 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1365 | KIDQTVEELR | Apolipoprotein A-IV | Serum | 1229.66157 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1366 | VKIDQTVEELR | Apolipoprotein A-IV | Serum | 1328.72998 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1367 | ARISASAEELRQR | Apolipoprotein A-IV | Serum | 1485.80119 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1368 | AKIDQNVEELKGR | Apolipoprotein A-IV | Serum | 1498.81036 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1369 | ELGGHLDQQVEEFR | Apolipoprotein A-IV | Serum | 1655.79035 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1370 | AEDVRGNLR | Apolipoprotein A-IV | Serum | 1028.53631 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1371 | VKIDQTVEEL | Apolipoprotein A-IV | Serum | 1172.62887 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1372 | KIDQNVEELK | Apolipoprotein A-IV | Serum | 1214.65067 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1373 | PLAEDVRGNLR | Apolipoprotein A-IV | Serum | 1238.67313 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1374 | ISASAEELRQR | Apolipoprotein A-IV | Serum | 1258.66296 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1375 | LAPLAEDVRGNL | Apolipoprotein A-IV | Serum | 1266.6932 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1376 | TQVNTQAEQLR | Apolipoprotein A-IV | Serum | 1286.65788 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1377 | APLAEDVRGNLR | Apolipoprotein A-IV | Serum | 1309.71025 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1378 | GGHLDQQVEEFR | Apolipoprotein A-IV | Serum | 1413.66369 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1379 | LAPLAEDVRGNLR | Apolipoprotein A-IV | Serum | 1422.79431 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1380 | LAELGGHLDQQVEEFR | Apolipoprotein A-IV | Serum | 1839.91153 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1381 | AELGGHLDQQVEEFRR | Apolipoprotein A-IV | Serum | 1882.92857 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1382 | SLAELGGHLDQQVEEFR | Apolipoprotein A-IV | Serum | 1926.94355 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1383 | ENADSLQASLRPHADELK | Apolipoprotein A-IV | Serum | 1992.98648 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1384 | SLAELGGHLDQQVEEFRR | Apolipoprotein A-IV | Serum | 2083.04467 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1385 | LTPYADEFKVKIDQTVEELR | Apolipoprotein A-IV | Serum | 2393.24784 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1386 | GRLTPYADEFKVKIDQTVEELR | Apolipoprotein A-IV | Serum | 2606.37042 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1387 | GNTEGLQKSLAELGGHLDQQVEEFR | Apolipoprotein A-IV | Serum | 2754.35729 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1388 | RVEPYGENFNKALVQQMEQLRQK | Apolipoprotein A-IV | Serum | 2804.43918 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1389 | GNTEGLQKSLAELGGHLDQQVEEFRR | Apolipoprotein A-IV | Serum | 2910.4584 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1390 | AELGGHLDQQVEEFR | Apolipoprotein A-IV | Serum | 1726.82746 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1391 | SLAELGGHLDQQVEEF | Apolipoprotein A-IV | Serum | 1770.84244 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1392 | PYADEFKVKIDQTVEELR | Apolipoprotein A-IV | Serum | 2179.1161 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1393 | SLAPYAQDTQEKLNHQLEGLTFQMK | Apolipoprotein A-IV | Serum | 2889.43309 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1394 | SLAPYAQDTQEKLNHQLEGLTFQM | Apolipoprotein A-IV | Serum | 2777.33304 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1395 | TLSLPELEQQQEQQQEQQQEQVQMLAPLES | Apolipoprotein A-IV | Serum | 3536.69407 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1396 | GNTEGLQK | Apolipoprotein A-IV | Serum | 845.4243 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1397 | AKIDQNVEELK | Apolipoprotein A-IV | Serum | 1285.68778 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1398 | LAEDVRGNLR | Apolipoprotein A-IV | Serum | 1141.62037 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1399 | LDQQVEEFR | Apolipoprotein A-IV | Serum | 1162.56185 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1400 | GNTEGLQKSLAELGGHLDQQVEEF | Apolipoprotein A-IV | Serum | 2598.25617 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1401 | SASAEELR | Apolipoprotein A-IV | Serum | 861.41921 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1402 | APLAEDVR | Apolipoprotein A-IV | Serum | 869.46068 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1403 | TPYADEFK | Apolipoprotein A-IV | Serum | 969.44436 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1404 | DQNVEELK | Apolipoprotein A-IV | Serum | 973.47164 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1405 | TQVNTQAEQL | Apolipoprotein A-IV | Serum | 1130.55677 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1406 | AKIDQNVEEL | Apolipoprotein A-IV | Serum | 1157.59282 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1407 | AKIDQNVEELKG | Apolipoprotein A-IV | Serum | 1342.70924 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1408 | RVEPYGENFNK | Apolipoprotein A-IV | Serum | 1351.65206 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1409 | GRLTPYADEFKV | Apolipoprotein A-IV | Serum | 1394.71942 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1410 | KIDQNVEELKGR | Apolipoprotein A-IV | Serum | 1427.77324 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1411 | ARLLPHANEVSQK | Apolipoprotein A-IV | Serum | 1461.80521 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1412 | RQLTPYAQRMER | Apolipoprotein A-IV | Serum | 1547.79908 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1413 | TQVNTQAEQ | Apolipoprotein A-IV | Serum | 1017.4727 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1414 | DQNVEELKG | Apolipoprotein A-IV | Serum | 1030.4931 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1415 | RVEPYGENFN | Apolipoprotein A-IV | Serum | 1223.5571 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1416 | RLTPYADEFK | Apolipoprotein A-IV | Serum | 1238.62954 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1417 | GRLTPYADEFK | Apolipoprotein A-IV | Serum | 1295.651 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1418 | SLAPYAQDTQEK | Apolipoprotein A-IV | Serum | 1349.64631 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1419 | NAEELKARISASAEELRQ | Apolipoprotein A-IV | Serum | 2014.04433 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1420 | AKIDQNVEELKGRLTPYADEFK | Apolipoprotein A-IV | Serum | 2563.32822 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1421 | ALVQQMEQLRQK | Apolipoprotein A-IV | Serum | 1470.79768 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1422 | VLRENADSLQASLRPHADEL | Apolipoprotein A-IV | Serum | 2233.14511 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1423 | LEPYADQLRTQVNTQAEQLR | Apolipoprotein A-IV | Serum | 2372.20844 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1424 | GRLTPYADEFKVKIDQTVEEL | Apolipoprotein A-IV | Serum | 2450.26931 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1425 | IDQTVEELR | Apolipoprotein A-IV | Serum | 1101.5666 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1426 | QLTPYAQRME | Apolipoprotein A-IV | Serum | 1235.59686 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1427 | IDQNVEELKGR | Apolipoprotein A-IV | Serum | 1299.67828 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1428 | DQTVEELR | Apolipoprotein A-IV | Serum | 988.48254 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1429 | TPYAQRME | Apolipoprotein A-IV | Serum | 994.45422 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1430 | IDQNVEELKG | Apolipoprotein A-IV | Serum | 1143.57717 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1431 | APLAEDVRGNL | Apolipoprotein A-IV | Serum | 1153.60914 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1432 | QRLAPLAEDVRGNL | Apolipoprotein A-IV | Serum | 1550.85289 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1433 | KIDQTVEEL | Apolipoprotein A-IV | Serum | 1073.56045 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1434 | PLAEDVRGNL | Apolipoprotein A-IV | Serum | 1082.57202 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1435 | GRLTPYADEF | Apolipoprotein A-IV | Serum | 1167.55604 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1436 | DQNVEELKGR | Apolipoprotein A-IV | Serum | 1186.59421 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1437 | LVQQMEQLRQ | Apolipoprotein A-IV | Serum | 1271.66561 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1438 | LTPYADEFKVKIDQTVEEL | Apolipoprotein A-IV | Serum | 2237.14673 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1439 | LGEVNTYAGDLQK | Apolipoprotein A-IV | Serum | 1406.70416 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1440 | ENADSLQASLRPHADEL | Apolipoprotein A-IV | Serum | 1864.89152 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1441 | VLRENADSLQASLRPHADELK | Apolipoprotein A-IV | Serum | 2361.24007 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1442 | RVEPYGENFNKALVQQMEQL | Apolipoprotein A-IV | Serum | 2392.18453 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1443 | AKIDQNVEELKGRLTPYADEF | Apolipoprotein A-IV | Serum | 2435.23325 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1444 | SLAPYAQDTQEKLNHQLEGLTFQM | Apolipoprotein A-IV | Serum | 2761.33813 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1445 | RLLPHANEVSQK | Apolipoprotein A-IV | Serum | 1390.7681 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1446 | VNTQAEQLR | Apolipoprotein A-IV | Serum | 1057.55162 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1447 | RQLTPYAQRME | Apolipoprotein A-IV | Serum | 1391.69797 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1448 | RVEPYGENFNKALVQQMEQLR | Apolipoprotein A-IV | Serum | 2548.28564 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1449 | RVEPYGENFNKALVQQMEQLRQ | Apolipoprotein A-IV | Serum | 2676.34422 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1450 | IGDNLRELQQRLEPYADQLR | Apolipoprotein A-IV | Serum | 2426.26662 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1451 | KIDQNVEEL | Apolipoprotein A-IV | Serum | 1086.5557 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1452 | KIDQNVEELKG | Apolipoprotein A-IV | Serum | 1271.67213 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1453 | NAEELKA | Apolipoprotein A-IV | Serum | 773.39193 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1454 | ASAEELR | Apolipoprotein A-IV | Serum | 774.38718 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1455 | IGDNLRELQ | Apolipoprotein A-IV | Serum | 1056.55637 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1456 | LLPHANEVSQK | Apolipoprotein A-IV | Serum | 1234.66699 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1457 | ASHLGLAR | Complement C3 | Serum | 823.46644 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1458 | SVQLTEKR | Complement C3 | Serum | 959.53999 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1459 | WESASLLR | Complement C3 | Serum | 960.50288 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1460 | IHWESASLL | Complement C3 | Serum | 1054.54475 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1461 | SVQLTEKRM | Complement C3 | Serum | 1090.58048 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1462 | IPIEDGSGEVVLSRK | Complement C3 | Serum | 1597.86754 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1463 | TLDPERLGR | Complement C3 | Serum | 1055.57236 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1464 | GYTQQLAFR | Complement C3 | Serum | 1082.55089 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1465 | IEDGSGEVVLSR | Complement C3 | Serum | 1259.63574 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1466 | RIPIEDGSGEVVLS | Complement C3 | Serum | 1469.77257 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1467 | SPMYSIITPNILR | Complement C3 | Serum | 1503.81194 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1468 | SEETKENEGFTVTAEGK | Complement C3 | Serum | 1854.84832 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1469 | LSINTHPSQKPLSITVR | Complement C3 | Serum | 1890.0687 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1470 | SNLDEDIIAEENIVSR | Complement C3 | Serum | 1815.88504 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1471 | SSKITHRIHWESASLL | Complement C3 | Serum | 1863.99553 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1472 | ILLQGTPVAQMTEDAVDAERLK | Complement C3 | Serum | 2397.25736 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1473 | SEETKENEGFTVTAEGKGQGTLSVVTMYHAK | Complement C3 | Serum | 3327.5929 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1474 | EGVQKEDIPPADLSDQVPDTESETRILLQGTPVAQMTEDAVDAERL | Complement C3 | Serum | 5005.43501 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1475 | QGALELIK | Complement C3 | Serum | 870.51747 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1476 | TGLQEVEVK | Complement C3 | Serum | 1001.53933 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1477 | VLLDGVQNPR | Complement C3 | Serum | 1109.61931 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1478 | RQGALELIKK | Complement C3 | Serum | 1154.71354 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1479 | QPSSAFAAFVKR | Complement C3 | Serum | 1307.69862 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1480 | TKKQELSEAEQATR | Complement C3 | Serum | 1617.83221 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1481 | RIPIEDGSGEVVLSR | Complement C3 | Serum | 1625.87368 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1482 | QPSSAFAAFVK | Complement C3 | Serum | 1151.59751 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1483 | SVQLTEKRMD | Complement C3 | Serum | 1205.60742 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1484 | QELSEAEQATR | Complement C3 | Serum | 1260.59461 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1485 | EDGSGEVVLSRK | Complement C3 | Serum | 1274.64664 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1486 | IEDGSGEVVLSRK | Complement C3 | Serum | 1387.73071 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1487 | SSKITHRIHWESASLLR | Complement C3 | Serum | 2020.09664 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1488 | VPVAVQGEDTVQSLTQGDGVAK | Complement C3 | Serum | 2197.12264 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1489 | GYTQQLAFRQPSSAFAAFVK | Complement C3 | Serum | 2216.13784 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1490 | AGDFLEANYMNLQR | Complement C3 | Serum | 1640.76169 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1491 | SGIPIVTSPYQIHFT | Complement C3 | Serum | 1658.86681 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1492 | SEETKENEGFTVTAEG | Complement C3 | Serum | 1726.75335 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1493 | NLDEDIIAEENIVSR | Complement C3 | Serum | 1728.85301 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1494 | VPVAVQGEDTVQSLTQGDGVA | Complement C3 | Serum | 2069.02768 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1495 | ILLQGTPVAQMTEDAVDAERL | Complement C3 | Serum | 2269.1624 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1496 | EGVQKEDIPPADLSDQVPDTESETR | Complement C3 | Serum | 2754.28318 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1497 | FGLEKR | Complement C3 | Serum | 748.42317 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1498 | LLDGVQNPR | Complement C3 | Serum | 1010.55089 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1499 | RQGALELIK | Complement C3 | Serum | 1026.61858 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1500 | ELSEAEQATR | Complement C3 | Serum | 1132.53603 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1501 | AAVYHHFISDG | Complement C3 | Serum | 1215.56727 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1502 | YHHFISDGVR | Complement C3 | Serum | 1229.59415 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1503 | VYHHFISDGVR | Complement C3 | Serum | 1328.66257 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1504 | KQELSEAEQATR | Complement C3 | Serum | 1388.68957 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1505 | AVYHHFISDGVR | Complement C3 | Serum | 1399.69968 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1506 | LTQSKIWDVVEK | Complement C3 | Serum | 1444.79258 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1507 | AAVYHHFISDGVRK | Complement C3 | Serum | 1598.83176 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1508 | NKLTQSKIWDVVEK | Complement C3 | Serum | 1686.93047 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1509 | LSINTHPSQKPLSITV | Complement C3 | Serum | 1733.96758 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1510 | RIPIEDGSGEVVLSRK | Complement C3 | Serum | 1753.96865 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1511 | QGALELIKK | Complement C3 | Serum | 998.61243 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1512 | SVQLTEKRMD | Complement C3 | Serum | 1221.60234 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1513 | KQELSEAEQAT | Complement C3 | Serum | 1232.58846 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1514 | KVLLDGVQNPR | Complement C3 | Serum | 1237.71427 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1515 | SGSDEVQVGQQR | Complement C3 | Serum | 1288.60076 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1516 | IPIEDGSGEVVLS | Complement C3 | Serum | 1313.67146 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1517 | GQGTLSVVTMYHA | Complement C3 | Serum | 1362.66019 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1518 | TKKQELSEAEQAT | Complement C3 | Serum | 1461.7311 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1519 | IPIEDGSGEVVLSR | Complement C3 | Serum | 1469.77257 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1520 | LSINTHPSQKPLSITVRT | Complement C3 | Serum | 1991.11637 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1521 | DFLEANYMNLQR | Complement C3 | Serum | 1512.70311 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1522 | SPMYSIITPNILR | Complement C3 | Serum | 1519.80685 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1523 | SNLDEDIIAEENIVS | Complement C3 | Serum | 1659.78393 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1524 | SGIPIVTSPYQIHFTK | Complement C3 | Serum | 1786.96177 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1525 | IRAYYENSPQQVFSTEFEVK | Complement C3 | Serum | 2434.18049 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1526 | VAVQGEDTVQSLTQGDGVAK | Complement C3 | Serum | 2001.00146 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1527 | IHWESASL | Complement C3 | Serum | 941.46068 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1528 | SLKVVPEGIR | Complement C3 | Serum | 1096.66044 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1529 | GPLLNKFLTTA | Complement C3 | Serum | 1173.67576 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1530 | GPLLNKFLTTAKD | Complement C3 | Serum | 1416.79767 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1531 | YTQQLAFR | Complement C3 | Serum | 1025.52943 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1532 | IEDGSGEVVLS | Complement C3 | Serum | 1103.53463 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1533 | AAVYHHFISDGV | Complement C3 | Serum | 1314.63569 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1534 | AAVYHHFISDGVR | Complement C3 | Serum | 1470.7368 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1535 | AGDFLEANYMNLQ | Complement C3 | Serum | 1484.66058 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1536 | GDFLEANYMNLQR | Complement C3 | Serum | 1569.72458 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1537 | VLLDGVQNPRAEDLVGK | Complement C3 | Serum | 1821.99486 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1538 | SGQSEDRQPVPGQQMTLK | Complement C3 | Serum | 1984.96364 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1539 | TLDPERLGREGVQKEDIPPADLSDQVPDTESETR | Complement C3 | Serum | 3791.84497 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1540 | VAVQGEDTVQSLTQGDGVA | Complement C3 | Serum | 1872.9065 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1541 | EDGSGEVVLSR | Complement C3 | Serum | 1146.55168 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1542 | MYSIITPNILR | Complement C3 | Serum | 1319.72714 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1543 | NLDEDIIAEENIVS | Complement C3 | Serum | 1572.7519 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1544 | SSLSVPYVIVPLKTGLQEVEVK | Complement C3 | Serum | 2384.35666 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1545 | GYTQQLAFRQPSSAFAAFV | Complement C3 | Serum | 2088.04287 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1546 | SEFPESWLWNVEDLKEPPKNGIST | Complement C3 | Serum | 2801.35483 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1547 | SVQLTEK | Complement C3 | Serum | 803.43888 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1548 | SDDKVTLEERLD | Complement C3 | Serum | 1418.6889 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1549 | IFTVNHKLLPVGR | Complement C3 | Serum | 1492.88782 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1550 | AVYHHFISDGVRK | Complement C3 | Serum | 1527.79465 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1551 | GIPIVTSPYQIHFT | Complement C3 | Serum | 1571.83478 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1552 | QKPDGVFQEDAPVIHQEMIGGL | Complement C3 | Serum | 2407.1842 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1553 | TMQALPYSTVGNSNNYLHLSVLR | Complement C3 | Serum | 2577.30096 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1554 | YFKPGMPFDLMVFVTNPDGSPAY | Complement C3 | Serum | 2592.2069 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1555 | HWESASLL | Complement C3 | Serum | 941.46068 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1556 | ATEHLSTLSEK | Apolipoprotein A-I | Serum | 1214.61428 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1557 | DEPPQSPWDR | Apolipoprotein A-I | Serum | 1225.53637 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1558 | VSFLSALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 1970.03606 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1559 | ATEHLSTLSEKAKPALEDLR | Apolipoprotein A-I | Serum | 2208.17501 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1560 | DEPPQSPWDRVKDLATVYVDVLK | Apolipoprotein A-I | Serum | 2669.37008 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1561 | AHVDALR | Apolipoprotein A-I | Serum | 780.42424 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1562 | AKPALEDLR | Apolipoprotein A-I | Serum | 1011.57129 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1563 | LHELQEKLSPLGEEMRDRA | Apolipoprotein A-I | Serum | 2250.14266 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1564 | AHVDALRTHLAPYSDELRQR | Apolipoprotein A-I | Serum | 2347.21452 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1565 | QGLLPVLESFK | Apolipoprotein A-I | Serum | 1229.70197 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1566 | DSGRDYVSQFEGSALG | Apolipoprotein A-I | Serum | 1686.74854 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1567 | KPALEDLR | Apolipoprotein A-I | Serum | 940.53418 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1568 | AELQEGARQ | Apolipoprotein A-I | Serum | 1000.49377 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1569 | THLAPYSDEL | Apolipoprotein A-I | Serum | 1144.54005 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1570 | THLAPYSDELR | Apolipoprotein A-I | Serum | 1300.64116 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1571 | THLAPYSDELRQ | Apolipoprotein A-I | Serum | 1428.69974 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1572 | RHFWQQDEPPQSPWDR | Apolipoprotein A-I | Serum | 2107.96127 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1573 | LHELQEKLSPLGEEMRDR | Apolipoprotein A-I | Serum | 2179.10555 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1574 | HLAPYSDELRQ | Apolipoprotein A-I | Serum | 1327.65206 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1575 | VEPLRAELQEGARQ | Apolipoprotein A-I | Serum | 1594.84272 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1576 | LAEYHAKATEHLSTLSEK | Apolipoprotein A-I | Serum | 2027.03237 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1577 | QKLHELQEKLSPLGEEMRDR | Apolipoprotein A-I | Serum | 2435.25909 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1578 | SALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 1523.78314 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1579 | QKVEPLRAELQEGA | Apolipoprotein A-I | Serum | 1566.83657 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1580 | DSGRDYVSQFEGSALGK | Apolipoprotein A-I | Serum | 1814.84351 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1581 | RLEALKENGGAR | Apolipoprotein A-I | Serum | 1312.72115 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1582 | LAARLEALKENGGA | Apolipoprotein A-I | Serum | 1411.77833 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1583 | EPPQSPWDR | Apolipoprotein A-I | Serum | 1110.50942 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1584 | WQEEMELYR | Apolipoprotein A-I | Serum | 1282.56522 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1585 | ATEHLSTLSEKAKPALEDL | Apolipoprotein A-I | Serum | 2052.0739 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1586 | QKLHELQEKLSPLGEEMRDRA | Apolipoprotein A-I | Serum | 2506.29621 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1587 | AKVQPYLDDFQK | Apolipoprotein A-I | Serum | 1450.74563 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1588 | DEPPQSPWDRVK | Apolipoprotein A-I | Serum | 1452.69974 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1589 | LLDNWDSVTSTFSK | Apolipoprotein A-I | Serum | 1611.77805 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1590 | QGLLPVLESF | Apolipoprotein A-I | Serum | 1101.60701 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1591 | LHELQEKLSPLGEEM | Apolipoprotein A-I | Serum | 1751.87639 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1592 | VSFLSALEEYT | Apolipoprotein A-I | Serum | 1257.61288 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1593 | VSFLSALEEYTK | Apolipoprotein A-I | Serum | 1385.70785 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1594 | LHELQEKLSPLGEEMR | Apolipoprotein A-I | Serum | 1907.9775 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1595 | DSGRDYVSQFEGSALGKQLNL | Apolipoprotein A-I | Serum | 2283.11314 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1596 | SFLSALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 1870.96764 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1597 | QKVEPLRAELQEGAR | Apolipoprotein A-I | Serum | 1722.93768 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1598 | VEPLRAELQEGA | Apolipoprotein A-I | Serum | 1310.68303 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1599 | LAARLEALKENGGAR | Apolipoprotein A-I | Serum | 1567.87944 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1600 | FLSALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 1783.93562 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1601 | VSFLSALEEYTKKLNT | Apolipoprotein A-I | Serum | 1841.97748 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1602 | DEPPQSPWDRVKDLATVYVDVL | Apolipoprotein A-I | Serum | 2541.27512 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1603 | LAEYHAKATEHLSTLSEKAKPALEDLR | Apolipoprotein A-I | Serum | 3020.5931 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1604 | FWQQDEPPQSPWDR | Apolipoprotein A-I | Serum | 1814.80125 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1605 | HLAPYSDELR | Apolipoprotein A-I | Serum | 1199.59349 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1606 | YSDELRQ | Apolipoprotein A-I | Serum | 909.41921 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1607 | TEHLSTLSEK | Apolipoprotein A-I | Serum | 1143.57717 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1608 | THLAPYSDELRQR | Apolipoprotein A-I | Serum | 1584.80085 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1609 | AELQEGARQK | Apolipoprotein A-I | Serum | 1128.58874 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1610 | PQGDAAQK | Alpha-1 protease inhibitor | Serum | 813.39808 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1611 | SASLHLPK | Alpha-1 protease inhibitor | Serum | 851.4865 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1612 | INDYVEK | Alpha-1 protease inhibitor | Serum | 879.4338 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1613 | EDPQGDAAQK | Alpha-1 protease inhibitor | Serum | 1057.46762 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1614 | SPLFMGKVVNPTQK | Alpha-1 protease inhibitor | Serum | 1544.83848 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1615 | SPLFMGKVVNPTQK | Alpha-1 protease inhibitor | Serum | 1560.8334 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1616 | SPLFMGKVVNPT | Alpha-1 protease inhibitor | Serum | 1288.68494 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1617 | LFMGKVVNPTQK | Alpha-1 protease inhibitor | Serum | 1360.75369 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1618 | SPLFMGKVVNPTQ | Alpha-1 protease inhibitor | Serum | 1416.74352 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1619 | SPLFMGKVVNPTQ | Alpha-1 protease inhibitor | Serum | 1432.73844 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1620 | SVLGQLGITKVFSNGADLSGVTEEAPLKLS | Alpha-1 protease inhibitor | Serum | 3029.62848 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1621 | SVLGQLGITK | Alpha-1 protease inhibitor | Serum | 1014.60735 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1622 | DAAQKTDTSHHDQDHPTFN | Alpha-1 protease inhibitor | Serum | 2163.92059 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1623 | VFSNGADLSGVTEEAPLKLS | Alpha-1 protease inhibitor | Serum | 2033.0317 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1624 | SPLFMGK | Alpha-1 protease inhibitor | Serum | 778.40475 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1625 | FLENEDR | Alpha-1 protease inhibitor | Serum | 921.41921 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1626 | SITGTYDLK | Alpha-1 protease inhibitor | Serum | 996.51278 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1627 | LSITGTYDLK | Alpha-1 protease inhibitor | Serum | 1109.59684 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1628 | KQINDYVEK | Alpha-1 protease inhibitor | Serum | 1135.58734 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1629 | AVHKAVLTIDEK | Alpha-1 protease inhibitor | Serum | 1322.7558 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1630 | EDPQGDAAQKT | Alpha-1 protease inhibitor | Serum | 1158.5153 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1631 | QINDYVEKGTQ | Alpha-1 protease inhibitor | Serum | 1293.62009 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1632 | SPLFMGKVVNPT | Alpha-1 protease inhibitor | Serum | 1304.67986 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1633 | KQINDYVEKGTQGK | Alpha-1 protease inhibitor | Serum | 1606.83148 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1634 | SASLHLPKLSITGTYDLK | Alpha-1 protease inhibitor | Serum | 1943.07278 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1635 | QINDYVEKGTQGK | Alpha-1 protease inhibitor | Serum | 1478.73652 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1636 | DAAQKTDTSHHDQDHPTFNK | Alpha-1 protease inhibitor | Serum | 2292.01555 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1637 | FMGKVVNPTQ | Alpha-1 protease inhibitor | Serum | 1119.57467 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1638 | LFMGKVVNPTQ | Alpha-1 protease inhibitor | Serum | 1232.65873 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1639 | EDPQGDAAQKTDTSHHDQDHPTFN | Alpha-1 protease inhibitor | Serum | 2690.12293 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1640 | SPLFMGKVV | Alpha-1 protease inhibitor | Serum | 976.54157 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1641 | TDTSHHDQDHPTFN | Alpha-1 protease inhibitor | Serum | 1650.66588 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1642 | INDYVEKGTQ | Alpha-1 protease inhibitor | Serum | 1165.56152 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1643 | QINDYVEKGTQG | Alpha-1 protease inhibitor | Serum | 1350.64156 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1644 | ITPNLAEFAFSLY | Alpha-1 protease inhibitor | Serum | 1484.75513 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1645 | DTEEEDFHVDQVTTVKVPMM | Alpha-1 protease inhibitor | Serum | 2349.05046 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1646 | VFSNGADLSGVTEEAPLK | Alpha-1 protease inhibitor | Serum | 1832.91561 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1647 | TLNQPDSQLQLTTGNGLFLSEGLK | Alpha-1 protease inhibitor | Serum | 2573.3337 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1648 | SVLGQLGITKVFSNGADLSGVTEEAPLK | Alpha-1 protease inhibitor | Serum | 2829.51239 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1649 | EDPQGDAAQ | Alpha-1 protease inhibitor | Serum | 929.37265 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1650 | FMGKVVNPT | Alpha-1 protease inhibitor | Serum | 991.51609 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1651 | NDYVEKGTQ | Alpha-1 protease inhibitor | Serum | 1052.47745 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1652 | SASLHLPKLSITGTYDL | Alpha-1 protease inhibitor | Serum | 1814.97781 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1653 | PQGDAAQKTDTSHHDQDHPTFN | Alpha-1 protease inhibitor | Serum | 2446.05339 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1654 | EDPQGDAAQKTDTSHHDQDHPTFNK | Alpha-1 protease inhibitor | Serum | 2818.21789 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1655 | NDYVEKGTQG | Alpha-1 protease inhibitor | Serum | 1109.49892 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1656 | VFSNGADLSGVTEEAPLKLSKAVH | Alpha-1 protease inhibitor | Serum | 2468.2911 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1657 | FNKPFVFLMIEQNT | Alpha-1 protease inhibitor | Serum | 1726.87526 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1658 | ITPNLAEFAFSLYR | Alpha-1 protease inhibitor | Serum | 1640.85624 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1659 | PSGEVSHPR | Alpha-2-HS-glycoprotein | Serum | 964.47264 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1660 | SPSGEVSHPR | Alpha-2-HS-glycoprotein | Serum | 1051.50467 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1661 | GSPSGEVSHPR | Alpha-2-HS-glycoprotein | Serum | 1108.52613 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1662 | PSGEVSHPRKT | Alpha-2-HS-glycoprotein | Serum | 1193.61528 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1663 | VVSLGSPSGEVSHPR | Alpha-2-HS-glycoprotein | Serum | 1506.77906 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1664 | LGSPSGEVSHPR | Alpha-2-HS-glycoprotein | Serum | 1221.6102 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1665 | SLGSPSGEVSHPR | Alpha-2-HS-glycoprotein | Serum | 1308.64223 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1666 | GSPSGEVSHPRKT | Alpha-2-HS-glycoprotein | Serum | 1337.66878 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1667 | VVSLGSPSGEVSHP | Alpha-2-HS-glycoprotein | Serum | 1350.67794 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1668 | LGSPSGEVSHPRKT | Alpha-2-HS-glycoprotein | Serum | 1450.75284 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1669 | SLGSPSGEVSHPRKT | Alpha-2-HS-glycoprotein | Serum | 1537.78487 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1670 | FMGVVSLGSPSGEVSHPR | Alpha-2-HS-glycoprotein | Serum | 1841.90942 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1671 | HTFMGVVSLGSPSGEVSHP | Alpha-2-HS-glycoprotein | Serum | 1939.90981 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1672 | HTFMGVVSLGSPSGEVSHPR | Alpha-2-HS-glycoprotein | Serum | 2080.01601 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1673 | HTFMGVVSLGSPSGEVSHPR | Alpha-2-HS-glycoprotein | Serum | 2096.01092 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1674 | HTFMGVVSLGSPSGEVSHPRKT | Alpha-2-HS-glycoprotein | Serum | 2309.15865 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1675 | HTFMGVVSLGSPSGEVSHPRKT | Alpha-2-HS-glycoprotein | Serum | 2325.15356 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1676 | AHYDLRHTFMGVVSLGSPSGEVSHPR | Alpha-2-HS-glycoprotein | Serum | 2835.38748 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1677 | VSLGSPSGEVSHPRKT | Alpha-2-HS-glycoprotein | Serum | 1636.85328 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1678 | FMGVVSLGSPSGEVSHP | Alpha-2-HS-glycoprotein | Serum | 1685.80831 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1679 | HTFMGVVSLGSPSGEVSHP | Alpha-2-HS-glycoprotein | Serum | 1923.9149 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1680 | SPSGEVSHPRKT | Alpha-2-HS-glycoprotein | Serum | 1280.64731 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1681 | AHYDLRHTFMGVVSLGSPSGEVSHPRKT | Alpha-2-HS-glycoprotein | Serum | 3064.53012 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1682 | VVSLGSPSGEVSHPRKT | Alpha-2-HS-glycoprotein | Serum | 1735.9217 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1683 | HTFMGVVSLGSPSG | Alpha-2-HS-glycoprotein | Serum | 1374.66019 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1684 | FMGVVSLGSPSGEVSHPRKT | Alpha-2-HS-glycoprotein | Serum | 2071.05206 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1685 | HTFMGVVSLGSPSGEVS | Alpha-2-HS-glycoprotein | Serum | 1689.80322 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1686 | VSLGSPSGEVSHPR | Alpha-2-HS-glycoprotein | Serum | 1407.71064 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1687 | GPLVEQGRVR | Apolipoprotein E | Serum | 1109.63054 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1688 | KVEQAVETEPEPELR | Apolipoprotein E | Serum | 1752.88939 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1689 | AATVGSLAGQPLQER | Apolipoprotein E | Serum | 1496.79471 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1690 | VQAAVGTSAAPVPSDNH | Apolipoprotein E | Serum | 1619.79035 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1691 | SELEEQLTPVAEETR | Apolipoprotein E | Serum | 1729.83702 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1692 | AATVGSLAGQPLQERAQAWGERL | Apolipoprotein E | Serum | 2408.25606 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1693 | AATVGSLAGQPLQERAQAWGERLR | Apolipoprotein E | Serum | 2564.35717 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1694 | VEQAVETEPEPELR | Apolipoprotein E | Serum | 1624.79443 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1695 | TVGSLAGQPLQERAQAWGERL | Apolipoprotein E | Serum | 2266.18183 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1696 | LGPLVEQGRV | Apolipoprotein E | Serum | 1066.61349 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1697 | RLAVYQAGAREGAER | Apolipoprotein E | Serum | 1645.86485 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1698 | GEVQAMLGQSTEELR | Apolipoprotein E | Serum | 1646.79338 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1699 | SELEEQLTPVAEETRA | Apolipoprotein E | Serum | 1800.87414 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1700 | AATVGSLAGQPLQERAQAWGER | Apolipoprotein E | Serum | 2295.17199 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1701 | LGPLVEQGR | Apolipoprotein E | Serum | 967.54508 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1702 | RLSKELQAAQAR | Apolipoprotein E | Serum | 1369.779 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1703 | ATVGSLAGQPLQER | Apolipoprotein E | Serum | 1425.75759 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1704 | AYKSELEEQLTPVAEET | Apolipoprotein E | Serum | 1935.93132 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1705 | AYKSELEEQLTPVAEETR | Apolipoprotein E | Serum | 2092.03243 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1706 | SELEEQLTPVAEET | Apolipoprotein E | Serum | 1573.73591 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1707 | KVEQAVETEPEPEL | Apolipoprotein E | Serum | 1596.78828 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1708 | GLSAIRERLGPLVEQGR | Apolipoprotein E | Serum | 1850.04863 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1709 | GRLVQYRGEVQAMLGQSTEELRV | Apolipoprotein E | Serum | 2618.35987 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1710 | VKDISEVVTPR | Complement factor B | Serum | 1241.69795 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1711 | QLNEINYEDHKL | Complement factor B | Serum | 1514.73652 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1712 | KDISEVVTPR | Complement factor B | Serum | 1142.62954 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1713 | ALFVSEEEKK | Complement factor B | Serum | 1178.6183 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1714 | ALFVSEEEKKLTR | Complement factor B | Serum | 1548.85116 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1715 | VSEADSSNADWVTK | Complement factor B | Serum | 1507.67907 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1716 | QLNEINYEDHK | Complement factor B | Serum | 1401.65246 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1717 | VSEADSSNADWVTKQLNEINYEDHKL | Complement factor B | Serum | 3004.40502 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1718 | DISEVVTPR | Complement factor B | Serum | 1014.53457 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1719 | DNEQHVFK | Complement factor B | Serum | 1015.47231 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1720 | QLNEINYEDH | Complement factor B | Serum | 1273.55749 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1721 | EKLQDEDLGFL | Complement factor B | Serum | 1305.64525 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1722 | ALFVSEEEKKLT | Complement factor B | Serum | 1392.75005 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1723 | ALFVSEEEKKLTRK | Complement factor B | Serum | 1676.94612 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1724 | STGSWSTLKTQDQ | Complement factor B | Serum | 1437.67359 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1725 | ALFVSEEEK | Complement factor B | Serum | 1050.52334 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1726 | YGLVTYATYPKIWV | Complement factor B | Serum | 1672.88648 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1727 | GIPEFYDYDVALIKL | Complement factor B | Serum | 1754.91309 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1728 | EAGIPEFYDYDVALIKL | Complement factor B | Serum | 1954.9928 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1729 | SASDLTWDNLK | Serotransferrin | Serum | 1248.59863 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1730 | SASDLTWDNLKGK | Serotransferrin | Serum | 1433.71506 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1731 | TAGWNIPMGLLYNKIN | Serotransferrin | Serum | 1803.93418 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1732 | ASDLTWDNLK | Serotransferrin | Serum | 1161.5666 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1733 | SASDLTWDNLKGKK | Serotransferrin | Serum | 1561.81002 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1734 | SDLTWDNLKGK | Serotransferrin | Serum | 1275.64592 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1735 | EGYYGYTGAFR | Serotransferrin | Serum | 1282.56185 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1736 | SASDLTWDNLKG | Serotransferrin | Serum | 1305.62009 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1737 | HQTVPQNTGGKNPDPWA | Serotransferrin | Serum | 1845.87581 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1738 | HQTVPQNTGGKNPDPWAK | Serotransferrin | Serum | 1973.97077 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1739 | TAGWNIPMGLLYNK | Serotransferrin | Serum | 1592.8021 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1740 | LHDRNTYEKYLGEEYVK | Serotransferrin | Serum | 2156.05383 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1741 | KSASDLTWDNLK | Serotransferrin | Serum | 1376.69359 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1742 | TAGWNIPMGLLYNK | Serotransferrin | Serum | 1576.80718 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1743 | SDLTWDNLKG | Serotransferrin | Serum | 1147.55095 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1744 | SDLTWDNLK | Serotransferrin | Serum | 1090.52949 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1745 | SASDLTWDNL | Serotransferrin | Serum | 1120.50367 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1746 | ASDLTWDNLKG | Serotransferrin | Serum | 1218.58807 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1747 | TAGWNIPMGLLYN | Serotransferrin | Serum | 1448.71222 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1748 | SEAEDASLLSFMQGYMKHATK | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 2343.08752 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1749 | TAKDALSSVQESQVAQQAR | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 2016.0236 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1750 | SEAEDASLLSFMQGYMKHAT | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 2214.99255 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1751 | SEAEDASLLSFMQGYMKHATKTAK | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 2643.26727 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1752 | DALSSVQESQVAQQA | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 1559.74273 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1753 | TAKDALSSVQESQVAQQA | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 1859.92248 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1754 | SEAEDASLLSFMQGYMKHAT | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 2230.98747 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1755 | SEAEDASLLSFMQGYMKHATKTA | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 2515.17231 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1756 | DALSSVQESQVAQQAR | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 1715.84384 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1757 | SEAEDASLLSFMQGYM | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 1777.75389 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1758 | SEAEDASLLSFMQGYMK | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 1905.84885 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1759 | HATKTAKDALSSVQESQVAQQA | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 2297.16115 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1760 | DALSSVQESQVAQQ | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 1488.70562 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1761 | HATKTAKDALSSVQESQVAQQAR | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 2453.26226 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1762 | SEAEDASLLSFMQGYMKHATKTA | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 2531.16722 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1763 | SEAEDASLLSFMQGYMK | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 1921.84377 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1764 | SEAEDASLLSFMQGYM | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 1793.7488 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1765 | EAEDASLLSFMQGYM | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 1690.72186 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1766 | AKDALSSVQESQVAQQA | Apolipoprotein C-III precursor (Apo-CIII) | Serum | 1758.87481 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1767 | ALYAQARA | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 862.4661 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1768 | ALYAQARAK | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 990.56106 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1769 | YAQARAKGK | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 991.55631 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1770 | AKGKTAGLVR | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 999.61891 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1771 | SIKEKTVGR | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1016.59784 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1772 | SSIKEKTVGR | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1103.62987 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1773 | YAQARAKGKTAGLVR | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1588.91616 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1774 | NDLISATKTQVADAKR | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1729.93226 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1775 | NDLISATKTQVADA | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1445.73619 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1776 | NDLISATKTQVADAK | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1573.83115 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1777 | TWRNDLISATKTQVADA | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1888.96429 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1778 | SSIKEKTVGRALYAQAR | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1877.04829 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1779 | SSIKEKTVGRALYAQARA | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1948.08541 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1780 | NVQFNYPHTSVTDVTQNNFHNYFGGSEIVVAGK | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 3682.74407 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1781 | NDLISATK | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 860.46035 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1782 | YGNQDTSSQLK | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1239.57314 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1783 | FYNQVSTPLLR | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1336.71394 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1784 | IYGNQDTSSQLK | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1352.65721 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1785 | IQPSGGTNINEALLR | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1581.84747 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1786 | YIEKIQPSGGTNINEALLR | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 2115.13242 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1787 | LSNENHGIAQRIYGNQDTSSQL | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 2444.16803 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1788 | YIEKIQPSGGTNINEALL | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1959.03131 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1789 | LSNENHGIAQR | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1237.61635 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1790 | LSNENHGIAQRIYGNQDTSSQLK | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 2572.26299 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1791 | IYGNQDTSSQLKKFYNQVSTPLL | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 2643.35443 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1792 | AEDHFSVIDFNQNIR | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1803.85401 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1793 | RLSNENHGIAQRIYGNQDTSSQL | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 2600.26914 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1794 | AKGKTAGLV | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 843.5178 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1795 | SIKEKTVG | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 860.49673 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1796 | SSIKEKTVG | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 947.52876 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1797 | ALYAQARAKGKTAGLV | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1616.93622 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1798 | VEGEIAEEAAEKAT | Serum deprivation-response protein | Serum | 1445.68857 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1799 | LVEGEIAEEAAEKA | Serum deprivation-response protein | Serum | 1457.72495 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1800 | SALVEGEIAEEAAEKAT | Serum deprivation-response protein | Serum | 1716.84177 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1801 | ALTSEEAERSDGDPVQPAVLQVHQTS | Serum deprivation-response protein | Serum | 2763.33113 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1802 | SYALTSEEAERSDGDPVQPAVLQVHQTS | Serum deprivation-response protein | Serum | 3013.42649 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1803 | YEGSYALTSEEAERSDGDPVQPAVLQVHQTS | Serum deprivation-response protein | Serum | 3362.55387 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1804 | VEGEIAEEAAEKA | Serum deprivation-response protein | Serum | 1344.64089 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1805 | EGEIAEEAAEKAT | Serum deprivation-response protein | Serum | 1346.62015 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1806 | ENETKSEDLPSSE | Serum deprivation-response protein | Serum | 1463.62636 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1807 | LVEGEIAEEAAEKAT | Serum deprivation-response protein | Serum | 1558.77263 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1808 | GDPVQPAVLQVHQTS | Serum deprivation-response protein | Serum | 1574.80527 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1809 | NDQEEESFAEGHSE | Serum deprivation-response protein | Serum | 1606.60194 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1810 | AERSDGDPVQPAVLQVHQTS | Serum deprivation-response protein | Serum | 2133.04506 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1811 | LTSEEAERSDGDPVQPAVLQVHQTS | Serum deprivation-response protein | Serum | 2692.29402 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1812 | SDMRQEKPSSPSPMPSSTPSPSLNLG | Serum deprivation-response protein | Serum | 2713.26873 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1813 | SEEAERSDGDPVQPAVLQVHQTS | Serum deprivation-response protein | Serum | 2478.16227 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1814 | IADNKQSSF | Inter-alpha-trypsin inhibitor heavy chain H1 | Serum | 1008.48762 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1815 | ISGENAGLVR | Inter-alpha-trypsin inhibitor heavy chain H1 | Serum | 1014.54581 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1816 | AISGENAGLVR | Inter-alpha-trypsin inhibitor heavy chain H1 | Serum | 1085.58292 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1817 | KAAISGENAGLV | Inter-alpha-trypsin inhibitor heavy chain H1 | Serum | 1128.61389 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1818 | IADNKQSSFK | Inter-alpha-trypsin inhibitor heavy chain H1 | Serum | 1136.58259 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1819 | AAISGENAGLVR | Inter-alpha-trypsin inhibitor heavy chain H1 | Serum | 1156.62004 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1820 | KAAISGENAGLVR | Inter-alpha-trypsin inhibitor heavy chain H1 | Serum | 1284.715 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1821 | GMADQDGLKPTIDKPSEDSPPLEMLGPR | Inter-alpha-trypsin inhibitor heavy chain H1 | Serum | 2993.44742 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1822 | GFSLDEATNLNGGLLR | Inter-alpha-trypsin inhibitor heavy chain H1 | Serum | 1675.85295 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1823 | QYYEGSEIVVAGR | Inter-alpha-trypsin inhibitor heavy chain H1 | Serum | 1469.71506 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1824 | SGENAGLVR | Inter-alpha-trypsin inhibitor heavy chain H1 | Serum | 901.46174 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1825 | AAISGENAGLV | Inter-alpha-trypsin inhibitor heavy chain H1 | Serum | 1000.51892 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1826 | QYYEGSEIVVAGRIADNKQSSF | Inter-alpha-trypsin inhibitor heavy chain H1 | Serum | 2460.19212 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1827 | GSLVQASEANLQAAQDFVR | Inter-alpha-trypsin inhibitor heavy chain H1 | Serum | 2003.00722 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1828 | KAAISGENAGL | Inter-alpha-trypsin inhibitor heavy chain H1 | Serum | 1029.54547 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1829 | GFSLDEATNLNGGLL | Inter-alpha-trypsin inhibitor heavy chain H1 | Serum | 1519.75184 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1830 | SLDYGFVTPLTSMSIR | Inter-alpha-trypsin inhibitor heavy chain H1 | Serum | 1785.89712 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1831 | MSLDYGFVTPLTSMSIR | Inter-alpha-trypsin inhibitor heavy chain H1 | Serum | 1916.93761 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1832 | SATGRSKSSEKR | Inter-alpha-trypsin inhibitor heavy chain H1 | Serum | 1292.67968 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1833 | EYQTFFNPR | Prothrombin | Serum | 1200.55637 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1834 | SEYQTFFNPR | Prothrombin | Serum | 1287.5884 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1835 | ATSEYQTFFNPR | Prothrombin | Serum | 1459.67319 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1836 | TATSEYQTFFNPR | Prothrombin | Serum | 1560.72087 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1837 | LEDKTERELLESYIDGR | Prothrombin | Serum | 2065.03276 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1838 | SLEDKTERELLESYIDGR | Prothrombin | Serum | 2152.06479 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1839 | IVEGSDAEIGMSPWQVMLF | Prothrombin | Serum | 2107.99585 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1840 | IVEGSDAEIGMSPWQVMLFR | Prothrombin | Serum | 2264.09696 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1841 | TSEYQTFFNPR | Prothrombin | Serum | 1388.63608 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1842 | SLEDKTERELLESYIDG | Prothrombin | Serum | 1995.96368 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1843 | IVEGSDAEIGMSPWQVMLF | Prothrombin | Serum | 2123.99076 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1844 | ENLDRDIALM | Prothrombin | Serum | 1188.58087 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1845 | KSLEDKTERELLESYIDGR | Prothrombin | Serum | 2280.15975 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1846 | GRVTGWGNLK | Prothrombin | Serum | 1086.59343 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1847 | EDKTERELLESYIDGR | Prothrombin | Serum | 1951.9487 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1848 | IVEGSDAEIGMSPWQVMLFRK | Prothrombin | Serum | 2392.19192 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1849 | EGSDAEIGMSPWQVMLF | Prothrombin | Serum | 1895.84337 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1850 | VEGSDAEIGMSPWQVMLF | Prothrombin | Serum | 1994.91179 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1851 | WIQKVIDQFGE | Prothrombin | Serum | 1361.69795 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1852 | IVEGSDAEIGMSPWQVML | Prothrombin | Serum | 1960.92744 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1853 | GSEMVVAGK | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 876.4375 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1854 | GPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 903.40865 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1855 | GSEMVVAGKLQ | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1117.58014 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1856 | GSEMVVAGKLQDR | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1388.7082 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1857 | TLRVQGNDHSATRE | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1582.78118 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1858 | YLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1888.02068 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1859 | GNDHSATRER | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1141.52245 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1860 | PGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1615.74194 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1861 | YYLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 2051.08401 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1862 | GLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1785.84747 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1863 | QGPVNLLSDPEQGVEVTGQYEREK | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 2671.30894 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1864 | EMVVAGKLQ | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 973.52665 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1865 | GLPGPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1170.56694 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1866 | TLRVQGNDHSATRER | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1738.88229 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1867 | RVQGNDHSATRER | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1524.75055 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1868 | ANTVQEATFQMELPK | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1705.83452 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1869 | TLRVQGNDHSAT | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1297.63748 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1870 | TLRVQGNDHSATR | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1453.73859 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1871 | LRVQGNDHSATRER | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1637.83461 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1872 | NPLVWVHASPEHVVVTR | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1939.04281 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1873 | NPLVWVHASPEHVVVT | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1782.9417 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1874 | TFEYPSNAVEEVTQNNF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1987.87995 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1875 | QGPVNLLSDPEQGVEVTGQYERE | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 2543.21398 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1876 | EKNGIDIYSLTVDSR | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 1708.86318 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1877 | ATASRGASQAGAPQGR | Gelsolin | Serum | 1484.7444 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1878 | ATASRGASQAGAPQG | Gelsolin | Serum | 1328.64329 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1879 | TASRGASQAGAPQGR | Gelsolin | Serum | 1413.70729 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1880 | GASQAGAPQGR | Gelsolin | Serum | 998.48936 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1881 | TASRGASQAGAPQG | Gelsolin | Serum | 1257.60618 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1882 | ATASRGASQAGAPQ | Gelsolin | Serum | 1271.62183 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1883 | TASRGASQAGAPQ | Gelsolin | Serum | 1200.58471 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1884 | SRGASQAGAPQ | Gelsolin | Serum | 1028.49992 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1885 | SRGASQAGAPQG | Gelsolin | Serum | 1085.52138 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1886 | SRGASQAGAPQGR | Gelsolin | Serum | 1241.62249 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1887 | PPGFSPFR | Kininogen-1 | Serum | 903.46029 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1888 | ITEATKTVG | Kininogen-1 | Serum | 918.50221 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1889 | RPPGFSPFR | Kininogen-1 | Serum | 1059.5614 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1890 | RPPGFSPFR | Kininogen-1 | Serum | 1059.5614 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1891 | QRQVVAGLNF | Kininogen-1 | Serum | 1130.61964 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1892 | AQRQVVAGLNF | Kininogen-1 | Serum | 1201.65676 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1893 | AQRQVVAGLNFR | Kininogen-1 | Serum | 1357.75787 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1894 | RHDWGHEKQR | Kininogen-1 | Serum | 1347.65446 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1895 | LDDDLEHQGGHVLDHGH | Kininogen-1 | Serum | 1892.84015 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1896 | FKLDDDLEHQGGHVLDHGH | Kininogen-1 | Serum | 2168.00353 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1897 | RPPGFSPF | Kininogen-1 | Serum | 903.46029 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1898 | SHALQLNNR | Complement C4-B | Serum | 1051.55229 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1899 | SRDKGQAGLQ | Complement C4-B | Serum | 1058.54687 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1900 | NGFKSHALQLNNR | Complement C4-B | Serum | 1497.78006 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1901 | NGFKSHALQLNNRQIR | Complement C4-B | Serum | 1895.02381 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1902 | DDPDAPLQPVTPLQLFEGRRN | Complement C4-B | Serum | 2377.20262 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1903 | TLEIPGNSDPNMIPDGDFNSYVR | Complement C4-B | Serum | 2550.16967 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1904 | TLEIPGNSDPNMIPDGDFNSYV | Complement C4-B | Serum | 2394.06856 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1905 | TTNIQGINLLFSSR | Complement C4-B | Serum | 1562.84166 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1906 | DDPDAPLQPVTPLQLFEG | Complement C4-B | Serum | 1950.95747 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1907 | DDPDAPLQPVTPLQLFEGR | Complement C4-B | Serum | 2107.05858 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1908 | VTASDPLDTLGSEGALSPGGVASLLR | Complement C4-B | Serum | 2482.2915 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1909 | TLEIPGNSDPNMIPDGDFNSYVR | Complement C4-B | Serum | 2566.16458 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1910 | ALEILQEEDLIDEDDIPVR | Complement C4-B | Serum | 2224.11107 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1911 | VGGNSKGTLKVLR | Complement C4-B | Serum | 1327.79358 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1912 | RGHLFLQTDQPIYNPGQR | Complement C4-B | Serum | 2139.09737 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1913 | GRTLEIPGNSDPNMIPDGDFNSYV | Complement C4-B | Serum | 2607.19113 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1914 | GRTLEIPGNSDPNMIPDGDFNSYVR | Complement C4-B | Serum | 2763.29224 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1915 | QIRGLEEELQFSLGSKINVK | Complement C4-B | Serum | 2287.2536 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1916 | SHALQLNN | Complement C4-B | Serum | 895.45118 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1917 | NGFKSHALQLNNRQI | Complement C4-B | Serum | 1738.9227 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1918 | GLEEELQFSLGSK | Complement C4-B | Serum | 1435.71947 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1919 | SHALQLNNRQIR | Complement C4-B | Serum | 1448.79604 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1920 | GFKSHALQLNNRQI | Complement C4-B | Serum | 1624.87977 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1921 | NGFKSHALQLNNRQ | Complement C4-B | Serum | 1625.83864 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1922 | KKEVYMPSSIFQDDFVIPDISEPGTWK | Complement C4-B | Serum | 3155.55254 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1923 | QGSFQGGFR | Complement C4-A | Serum | 982.46208 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1924 | ETIEQEKQAGES | Thymosin beta-4 | Serum | 1347.6154 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1925 | NPLPSKETIEQEKQAGES | Thymosin beta-4 | Serum | 1983.97491 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1926 | KNPLPSKETIEQEKQAGES | Thymosin beta-4 | Serum | 2112.06988 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1927 | QEKNPLPSKETIEQEKQAGES | Thymosin beta-4 | Serum | 2369.17105 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1928 | TETQEKNPLPSKETIEQEKQAGES | Thymosin beta-4 | Serum | 2700.309 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1929 | PSKETIEQEKQAGES | Thymosin beta-4 | Serum | 1659.79516 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1930 | TQEKNPLPSKETIEQEKQAGES | Thymosin beta-4 | Serum | 2470.21873 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1931 | LPSKETIEQEKQAGES | Thymosin beta-4 | Serum | 1772.87922 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1932 | EKNPLPSKETIEQEKQAGES | Thymosin beta-4 | Serum | 2241.11247 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1933 | KTETQEKNPLPSKETIEQEKQAGES | Thymosin beta-4 | Serum | 2828.40396 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1934 | ATEDEGSEQKIPEATNR | Antithrombin-III | Serum | 1873.86536 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1935 | AFLEVNEEGSEAAASTAVVIAGR | Antithrombin-III | Serum | 2290.1441 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1936 | KATEDEGSEQKIPEATNR | Antithrombin-III | Serum | 2001.96033 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1937 | SPEKKATEDEGSEQKIPEATNR | Antithrombin-III | Serum | 2443.18267 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1938 | LQPLDFKENAEQSR | Antithrombin-III | Serum | 1673.8373 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1939 | SKLPGIVAEGRDDLYVSDAFH | Antithrombin-III | Serum | 2288.14371 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1940 | SKLPGIVAEGRDDLYVSDAFHK | Antithrombin-III | Serum | 2416.23867 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1941 | EQLQDMGLVDLFSPEK | Antithrombin-III | Serum | 1847.89752 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1942 | ATEDEGSEQKIPEATN | Antithrombin-III | Serum | 1717.76425 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1943 | EKKATEDEGSEQKIPEATNR | Antithrombin-III | Serum | 2259.09788 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1944 | VGFYESDVMGR | Alpha-2-macroglobulin | Serum | 1258.56522 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1945 | FYESDVMGR | Alpha-2-macroglobulin | Serum | 1102.47534 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1946 | SKAIGYLNTGYQR | Alpha-2-macroglobulin | Serum | 1469.76268 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1947 | SLNEEAVKK | Alpha-2-macroglobulin | Serum | 1016.55022 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1948 | SASNMAIVDVK | Alpha-2-macroglobulin | Serum | 1133.57506 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1949 | AIGYLNTGYQR | Alpha-2-macroglobulin | Serum | 1254.63569 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1950 | SKAIGYLNTGYQ | Alpha-2-macroglobulin | Serum | 1313.66157 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1951 | SKAIGYLNTGYQRQLNY | Alpha-2-macroglobulin | Serum | 1988.01157 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1952 | VGFYESDVMGRGHA | Alpha-2-macroglobulin | Serum | 1523.68271 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1953 | VGFYESDVMGR | Alpha-2-macroglobulin | Serum | 1274.56014 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1954 | GFYESDVMGRGHA | Alpha-2-macroglobulin | Serum | 1424.6143 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1955 | AIGYLNTGYQRQLNY | Alpha-2-macroglobulin | Serum | 1772.88458 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1956 | YESDVMGR | Alpha-2-macroglobulin | Serum | 955.40693 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1957 | VGFYESDVMGRGHAR | Alpha-2-macroglobulin | Serum | 1679.78382 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1958 | YESDVMGRG | Alpha-2-macroglobulin | Serum | 1012.42839 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1959 | VGFYESDVMGRG | Alpha-2-macroglobulin | Serum | 1315.58669 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1960 | YESDVMGRGH | Alpha-2-macroglobulin | Serum | 1149.48731 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1961 | IGYLNTGYQRQLNY | Alpha-2-macroglobulin | Serum | 1701.84747 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1962 | VGFYESDVMGRGH | Alpha-2-macroglobulin | Serum | 1452.6456 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1963 | FYESDVMGRGH | Alpha-2-macroglobulin | Serum | 1296.55572 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1964 | DSLEFREIGELYLPK | Alpha-1-antichymotrypsin | Serum | 1807.93562 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1965 | NSPLDEENLTQENQDR | Alpha-1-antichymotrypsin | Serum | 1900.83988 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1966 | HPNSPLDEENLTQENQDR | Alpha-1-antichymotrypsin | Serum | 2134.95155 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1967 | ADLSGITGARNLAVSQVVH | Alpha-1-antichymotrypsin | Serum | 1907.02247 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1968 | LYGSEAFATDFQDSAAAK | Alpha-1-antichymotrypsin | Serum | 1890.86357 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1969 | RLYGSEAFATDFQDSAAA | Alpha-1-antichymotrypsin | Serum | 1918.86972 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1970 | ADLSGITGAR | Alpha-1-antichymotrypsin | Serum | 959.50361 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1971 | NLAVSQVVHK | Alpha-1-antichymotrypsin | Serum | 1093.62439 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1972 | ADLSGITGARNLAVSQVVHK | Alpha-1-antichymotrypsin | Serum | 2035.11744 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1973 | MEPLGRQLTSGPNQEQVSPLTLL | Alpha-2-antiplasmin | Serum | 2507.30537 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1974 | GFPRGDKLFGPDLKLVPPMEEDYPQFGSPK | Alpha-2-antiplasmin | Serum | 3360.68528 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1975 | DSFHLDEQFTVPVEMMQA | Alpha-2-antiplasmin | Serum | 2122.93398 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1976 | DFLQSLK | Alpha-2-antiplasmin | Serum | 849.45962 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1977 | DSFHLDEQFTVPVEMMQAR | Alpha-2-antiplasmin | Serum | 2279.03509 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1978 | MEPLGRQLTSGPNQEQVSPLTLLK | Alpha-2-antiplasmin | Serum | 2635.40034 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1979 | LGNQEPGGQTALK | Alpha-2-antiplasmin | Serum | 1311.67828 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1980 | QLTSGPNQEQVSPLTLLK | Alpha-2-antiplasmin | Serum | 1952.05786 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1981 | EQQDSPGNKDFLQSLK | Alpha-2-antiplasmin | Serum | 1832.89046 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1982 | LFGPDLKLVPPMEEDYPQFGSPK | Alpha-2-antiplasmin | Serum | 2603.29816 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1983 | NQEQVSPLTLLK | Alpha-2-antiplasmin | Serum | 1368.76128 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1984 | QLTSGPNQEQVSPLTLL | Alpha-2-antiplasmin | Serum | 1823.96289 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1985 | VNEPSILEMS | Apolipoprotein-L1 | Serum | 1117.53253 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1986 | VNEPSILEMSR | Apolipoprotein-L1 | Serum | 1273.63364 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1987 | VTEPISAESGEQVER | Apolipoprotein-L1 | Serum | 1629.78459 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1988 | VTEPISAESGEQVERVNEPSILEMS | Apolipoprotein-L1 | Serum | 2729.30655 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1989 | VTEPISAESGEQVERVNEPSILEMSR | Apolipoprotein-L1 | Serum | 2885.40767 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1990 | VTEPISAESGEQVERVNEPSILEMS | Apolipoprotein-L1 | Serum | 2745.30147 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1991 | VTEPISAESGEQVERVNEPSILEMSR | Apolipoprotein-L1 | Serum | 2901.40258 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1992 | ILQADQEL | Apolipoprotein-L1 | Serum | 928.48656 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1993 | VAQELEEKLNILNNNY | Apolipoprotein-L1 | Serum | 1902.96871 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1994 | TEPISAESGEQVER | Apolipoprotein-L1 | Serum | 1530.71618 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1995 | VAQELEEKLNILNNNYK | Apolipoprotein-L1 | Serum | 2031.06367 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1996 | SPELQAEAK | Apolipoprotein A-II | Serum | 971.49238 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1997 | VKSPELQAEAK | Apolipoprotein A-II | Serum | 1198.65575 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1998 | SKEQLTPLI | Apolipoprotein A-II | Serum | 1027.59136 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1999 | VKSPELQAEA | Apolipoprotein A-II | Serum | 1070.56079 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2000 | VNPFRPGDSEPPPAPGAQRAQ | Zyxin | Serum | 2187.08211 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2001 | NTQPRGPPASSPAPAPKFSPVTPKFTPVAS | Zyxin | Serum | 3030.5927 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2002 | GPPASSPAPAPKFSPVTPKFTPVAS | Zyxin | Serum | 2434.28965 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2003 | LANTQPRGPPASSPAPAPKFSPVTPKFTPVAS | Zyxin | Serum | 3214.71388 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2004 | VSLANTQPRGPPASSPAPAPKFSPVTPKFTPVAS | Zyxin | Serum | 3400.81433 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2005 | KFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTY | Zyxin | Serum | 3737.8074 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2006 | VNPFRPGDSEPPPAPGAQ | Zyxin | Serum | 1831.88531 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2007 | TQPRGPPASSPAPAPKF | Zyxin | Serum | 1704.89475 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2008 | VNPFRPGDSEPPPAPGA | Zyxin | Serum | 1703.82673 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2009 | EEIFPSPPPPPEEEGGPEAPIPPPPQPREKVS | Zyxin | Serum | 3426.69835 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2010 | HVQPQPQPKPQVQLH | Zyxin | Serum | 1759.94819 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2011 | GAPGPLTLKEVEELE | Zyxin | Serum | 1580.82975 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2012 | HVQPQPQPKPQVQLHVQSQT | Zyxin | Serum | 2303.21346 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2013 | FSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTY | Zyxin | Serum | 3609.71244 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2014 | KFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQ | Zyxin | Serum | 4064.96167 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2015 | TPALHFK | Apolipoprotein B-100 | Serum | 812.45447 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2016 | KSHDELPR | Apolipoprotein B-100 | Serum | 980.50394 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2017 | EKSHDELPR | Apolipoprotein B-100 | Serum | 1109.54654 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2018 | AEKSHDELPR | Apolipoprotein B-100 | Serum | 1180.58365 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2019 | AASGTTGTYQEWK | Apolipoprotein B-100 | Serum | 1398.64156 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2020 | SVSDGIAALDLNAVANK | Apolipoprotein B-100 | Serum | 1656.86826 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2021 | SVSDGIAALDLNAVAN | Apolipoprotein B-100 | Serum | 1528.7733 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2022 | SGTTGTYQEWK | Apolipoprotein B-100 | Serum | 1256.56733 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2023 | IADFELPTIIVPEQTIEIPSIK | Apolipoprotein B-100 | Serum | 2465.36689 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2024 | DLKVEDIPLA | Apolipoprotein B-100 | Serum | 1111.61249 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2025 | RPHFFFPK | Clusterin | Serum | 1074.57632 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2026 | FMETVAEKALQEYR | Clusterin | Serum | 1713.83961 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2027 | DQTVSDNELQEMSNQGSK | Clusterin | Serum | 2008.86438 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2028 | TLLSNLEEAK | Clusterin | Serum | 1116.60265 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2029 | FMETVAEKALQEY | Clusterin | Serum | 1557.7385 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2030 | TLIEKTNEER | Clusterin | Serum | 1231.64083 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2031 | SLDRNLPSDSQDLGQHGLEED | Secretory granule proteoglycan core protein | Serum | 2324.05166 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2032 | SLDRNLPSDSQDLGQHGLEEDFM | Secretory granule proteoglycan core protein | Serum | 2602.16056 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2033 | SLDRNLPSDSQDLGQHGLEEDF | Secretory granule proteoglycan core protein | Serum | 2471.12007 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2034 | NLPSDSQDLGQHGLEED | Secretory granule proteoglycan core protein | Serum | 1852.80751 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2035 | SLDRNLPSDSQDLGQHGLEEDFML | Secretory granule proteoglycan core protein | Serum | 2715.24462 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2036 | VNDLYIQK | Heparin cofactor 2 | Serum | 991.53385 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2037 | TLEAQLTPR | Heparin cofactor 2 | Serum | 1027.56621 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2038 | GSKGPLDQLEK | Heparin cofactor 2 | Serum | 1170.62445 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2039 | SVNDLYIQK | Heparin cofactor 2 | Serum | 1078.56587 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2040 | RNFGYTLR | Heparin cofactor 2 | Serum | 1025.54066 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2041 | LNEREVVKVSMMQT | Heparin cofactor 2 | Serum | 1662.84331 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2042 | TLEAQLTPRVVERWQ | Heparin cofactor 2 | Serum | 1824.98463 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2043 | GGETAQSADPQWEQLNNK | Heparin cofactor 2 | Serum | 1971.89225 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2044 | GSKGPLDQLEKGGETAQSADPQWEQLNN | Heparin cofactor 2 | Serum | 2996.41117 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2045 | AVPPNNSNAAEDDLPTVELQGVVPR | Coagulation factor XIII A chain | Serum | 2601.30346 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2046 | RAVPPNNSNAAEDDLPTVELQGVVPR | Coagulation factor XIII A chain | Serum | 2757.40457 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2047 | TAFGGRRAVPPNNSNAAEDDLPTVELQGVVPR | Coagulation factor XIII A chain | Serum | 3346.70181 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID2048 | NNSNAAEDDLPTVELQGVVPR | Coagulation factor XIII A chain | Serum | 2237.0924 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2049 | VPPNNSNAAEDDLPTVELQGVVPR | Coagulation factor XIII A chain | Serum | 2530.26635 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2050 | EEDEEVTEEAEMEPEDKGH | Tubulin beta-1 chain | Serum | 2230.86958 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2051 | SVMPSPKVSDTVVEPYN | Tubulin beta-1 chain | Serum | 1847.89752 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2052 | AKAVLEEDEEVTEEAEMEPEDKGH | Tubulin beta-1 chain | Serum | 2713.19125 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2053 | PSPKVSDTVVEPYN | Tubulin beta-1 chain | Serum | 1530.75659 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2054 | VMPSPKVSDTVVEPYN | Tubulin beta-1 chain | Serum | 1760.86549 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2055 | VLEEDEEVTEEAEMEPEDKGH | Tubulin beta-1 chain | Serum | 2443.02206 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2056 | DINEFGEAENNIHDLV | Tubulin beta-1 chain | Serum | 1827.82752 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2057 | QPPTVVPGGDLAKV | Tubulin alpha-6 chain | Serum | 1376.76637 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2058 | DGALNVDLTEFQTN | Tubulin alpha-6 chain | Serum | 1535.71037 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2059 | EGMEEGEFSEAREDM | Tubulin alpha-6 chain | Serum | 1744.65563 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2060 | SIYPAPQVSTAVVEPYN | Tubulin alpha-6 chain | Serum | 1833.91488 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2061 | EQLITGKEDAANN | Tubulin alpha-6 chain | Serum | 1401.67359 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2062 | EQLITGKEDAANNY | Tubulin alpha-6 chain | Serum | 1564.73692 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2063 | QPPTVVPGGDLAKVQ | Tubulin alpha-6 chain | Serum | 1504.82494 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2064 | KSNEQATSLNTVGGTGGIGGVGGTGGVGNRAPR | Multimerin-1 | Serum | 3025.52894 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2065 | KSNEQATSLNTVGGTGGIGGVGGTGGVGNR | Multimerin-1 | Serum | 2701.33795 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2066 | KSNEQATSLNTVGGTGGIGGVGGTGGVGNRAP | Multimerin-1 | Serum | 2869.42782 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2067 | MAVEDIISR | Complement component C8 alpha | Serum | 1032.52738 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2068 | AMAVEDIISR | Complement component C8 alpha | Serum | 1103.56449 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2069 | KAMAVEDIISRVR | Complement component C8 alpha | Serum | 1486.82898 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2070 | LLEVPEGRTNFDNDIALVR | Complement C1s subcomponent | Serum | 2170.13823 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2071 | TMQENSTPRED | Complement C1s subcomponent | Serum | 1306.54594 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2072 | TNFDNDIALVR | Complement C1s subcomponent | Serum | 1276.64116 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2073 | SKMLTPEHVFIHPGWK | Complement C1s subcomponent | Serum | 1905.99236 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2074 | TNFDNDIALVRLKDPV | Complement C1s subcomponent | Serum | 1828.96831 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2075 | AARLPVAPLR | Complement C1s subcomponent | Serum | 1062.6662 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2076 | SMEDKGMTNINDGLL | Inter-alpha-trypsin inhibitor heavy chain H3 | Serum | 1636.74366 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2077 | SMEDKGMTNINDGLLR | Inter-alpha-trypsin inhibitor heavy chain H3 | Serum | 1792.84477 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2078 | AVSQGKTAGLV | Inter-alpha-trypsin inhibitor heavy chain H3 | Serum | 1029.58186 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2079 | EHLVQATPENLQEA | Inter-alpha-trypsin inhibitor heavy chain H3 | Serum | 1577.76855 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2080 | SLPEGVANGIEVYSTK | Inter-alpha-trypsin inhibitor heavy chain H3 | Serum | 1662.84647 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2081 | NADYSYSVWK | Complement C5 | Serum | 1231.55095 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2082 | TLLPVSKPEIR | Complement C5 | Serum | 1251.75507 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2083 | TLLPVSKPEI | Complement C5 | Serum | 1095.65396 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2084 | DSSVPNTGTAR | Complement C5 | Serum | 1103.52072 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2085 | ESYSGVTLDPRGIYGTIS | Complement C5 | Serum | 1913.93707 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2086 | DNLQHKDSSVPNTGTA | Complement C5 | Serum | 1682.78599 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2087 | DTNRASVGQDSPEPR | Plexin domain-containing protein 2 | Serum | 1627.75503 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2088 | ASVGQDSPEPR | Plexin domain-containing protein 2 | Serum | 1141.53637 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2089 | VDTNRASVGQDSPEPR | Plexin domain-containing protein 2 | Serum | 1726.82344 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2090 | VGQDSPEPR | Plexin domain-containing protein 2 | Serum | 983.46722 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2091 | AVDTNRASVGQDSPEPR | Plexin domain-containing protein 2 | Serum | 1797.86055 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2092 | LRTEGDGVYTLNDKKQWINK | Haptoglobin-related protein | Serum | 2377.23901 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2093 | LGGHLDAKGSFPWQA | Haptoglobin-related protein | Serum | 1582.78923 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2094 | LRTEGDGVYTLNDKKQWIN | Haptoglobin-related protein | Serum | 2249.14405 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2095 | RTEGDGVYTLNDKKQWIN | Haptoglobin-related protein | Serum | 2136.05998 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2096 | VGYVSGWGRN | Haptoglobin | Serum | 1093.53049 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2097 | VGYVSGWGR | Haptoglobin | Serum | 979.48756 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2098 | LRTEGDGVYTLNNEKQWIN | Haptoglobin | Serum | 2249.10766 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2099 | VAAGAFQGLR | Leucine-rich alpha-2-glycoprotein | Serum | 988.54541 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2100 | GQTLLAVAKSQ | Leucine-rich alpha-2-glycoprotein | Serum | 1114.63462 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2101 | AGAFQGLR | Leucine-rich alpha-2-glycoprotein | Serum | 818.43989 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2102 | TLDLGENQLETLPPDLLR | Leucine-rich alpha-2-glycoprotein | Serum | 2036.07899 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2103 | YLFLNGNKLA | Leucine-rich alpha-2-glycoprotein | Serum | 1151.63389 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2104 | TLDLGENQLETLPPDLLRGPLQLER | Leucine-rich alpha-2-glycoprotein | Serum | 2829.52362 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2105 | AADDTWEPFASGK | Transthyretin | Serum | 1393.61501 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2106 | ADDTWEPFASGK | Transthyretin | Serum | 1322.5779 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2107 | ALGISPFHEHAEVVFTANDSGPR | Transthyretin | Serum | 2450.19787 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2108 | YTIAALLSPYSYSTTAVVTNPKE | Transthyretin | Serum | 2488.27372 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2109 | GSPAINVAVHVF | Transthyretin | Serum | 1209.65061 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2110 | DDTWEPFASGK | Transthyretin | Serum | 1251.54078 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2111 | AALLSPYSYSTTAVVTNPKE | Transthyretin | Serum | 2111.07865 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2112 | DEEAKTTTTNT | Caldesmon | Serum | 1209.53609 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2113 | DEEAKTTTTNTQ | Caldesmon | Serum | 1337.59467 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2114 | SAKPTKPAASDLPVPAEGVRNIK | Caldesmon | Serum | 2345.30669 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2115 | RMQNDTAENETTEKEEKSES | Caldesmon | Serum | 2355.01323 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2116 | NSVIKVPMMN | Plasma protease C1 inhibitor | Serum | 1131.57804 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2117 | NSVIKVPMMNS | Plasma protease C1 inhibitor | Serum | 1218.61006 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2118 | AIMEKLEMSKFQPTLLTLPR | Plasma protease C1 inhibitor | Serum | 2345.2851 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2119 | NDNEEGFFS | Fibrinogen beta | Serum | 1057.39887 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2120 | EEAPSLRPAPPPISGGGY | Fibrinogen beta | Serum | 1793.89481 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2121 | REEAPSLRPAPPPISGGGY | Fibrinogen beta | Serum | 1949.99592 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2122 | DNEEGFFSA | Fibrinogen beta | Serum | 1014.39306 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2123 | VNDNEEGFFSA | Fibrinogen beta | Serum | 1227.5044 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2124 | DNEEGFF | Fibrinogen beta | Serum | 856.32391 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2125 | NDNEEGFF | Fibrinogen beta | Serum | 970.36684 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2126 | DNEEGFFS | Coagulation factor XII | Serum | 943.35594 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2127 | IPPWEAPKE | Coagulation factor XII | Serum | 1065.5495 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2128 | IPPWEAPKEHK | Plasminogen | Serum | 1330.70337 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2129 | LDDYVNTQGASLFSVTK | Plasminogen | Serum | 1856.91561 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2130 | MRDVVLFEK | Plasminogen | Serum | 1135.60597 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2131 | EPLDDYVNTQGASLFSVTKK | Plasminogen | Serum | 2211.10593 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2132 | EPLDDYVNTQGASLFSVTK | Ceruloplasmin | Serum | 2083.01097 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2133 | NNEGTYYSPNYNPQS | Ceruloplasmin | Serum | 1746.71216 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2134 | NNEGTYYSPNYNPQSR | Ceruloplasmin | Serum | 1902.81327 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2135 | KALYLQYTDETF | Ceruloplasmin | Serum | 1490.72931 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2136 | FNKNNEGTYYSPNYNPQS | Ceruloplasmin | Serum | 2135.91846 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2137 | DNEDFQESNR | Ceruloplasmin | Serum | 1252.49562 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2138 | MFTTAPDQVDKEDEDFQESNK | Ceruloplasmin | Serum | 2473.05911 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2139 | LISVDTEHSNIYLQNGPDRIGRLY | Ceruloplasmin | Serum | 2772.41949 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2140 | TYSDHPEKVNKDDEEFIESN | Ceruloplasmin | Serum | 2395.04518 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2141 | GNFPWQVFTNIHG | Complement C1r subcomponent | Serum | 1515.7259 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2142 | MGNFPWQVFTNIHGR | Complement C1r subcomponent | Serum | 1802.86749 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2143 | MGNFPWQVFTNIHG | Complement C1r subcomponent | Serum | 1646.76638 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2144 | NFPWQVFTNIHG | Complement C1r subcomponent | Serum | 1458.70443 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2145 | SWVPHTFESELSDPVELLVAES | Alpha-1B-glycoprotein | Serum | 2470.19039 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2146 | RGEKELLVPR | Alpha-1B-glycoprotein | Serum | 1195.70371 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2147 | GVTFLLR | Alpha-1B-glycoprotein | Serum | 804.48577 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2148 | PPAQQQITSGQMH | Talin-1 | Serum | 1421.67215 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2149 | MPPAQQQITSGQMH | Talin-1 | Serum | 1552.71263 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2150 | FGLEGDEESTMLEDSVSPK | Talin-1 | Serum | 2068.91468 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2151 | FGLEGDEESTMLEDSVSPKKSTVLQ | Talin-1 | Serum | 2725.30041 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2152 | SYDLDPGAGSLEI | Apolipoprotein F | Serum | 1335.61943 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2153 | DLDPGAGSLEI | Apolipoprotein F | Serum | 1085.52407 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2154 | NRIPESGGDNSVFDIFELTGAARKGSGR | Thrombospondin-1 | Serum | 2949.4693 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2155 | NRIPESGGDNSVFDIFELTGAAR | Thrombospondin-1 | Serum | 2464.19827 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2156 | NRIPESGGDNSVFDIFELTGAA | Thrombospondin-1 | Serum | 2308.09715 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2157 | RLVKGPDPSSPAF | Thrombospondin-1 | Serum | 1369.7354 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2158 | SVVPSPKVSDTVVEPYN | Tubulin beta chain | Serum | 1815.92544 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2159 | EEEEDFGEEAEEEA | Tubulin beta chain | Serum | 1640.58495 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2160 | SVVPSPKVSDTVVEPYNATLSVHQL | Tubulin beta chain | Serum | 2665.3963 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2161 | ALYYDLISSPDIHGTYK | Pigment epithelium-derived factor | Serum | 1954.96764 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2162 | ELLDTVTAPQKNL | Pigment epithelium-derived factor | Serum | 1440.78241 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2163 | VPVNKLAAAVSNFGYDLY | Pigment epithelium-derived factor | Serum | 1940.00436 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2164 | ALYYDLISSPDIHGTY | Pigment epithelium-derived factor | Serum | 1826.87268 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2165 | LQSLFDSPDFSKITGKPIKLTQVEH | Pigment epithelium-derived factor | Serum | 2827.512 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2166 | EALQGVGDMGR | Serum amyloid A-4 protein | Serum | 1131.53426 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2167 | SNEKAEEWGR | Serum amyloid A-4 protein | Serum | 1204.54726 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2168 | SQHLDNFSNQIGKHY | Coagulation factor V | Serum | 1786.8387 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2169 | PMRGESVTVT | Coagulation factor V | Serum | 1075.53319 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2170 | SEAYNTFSER | Coagulation factor V | Serum | 1202.52038 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2171 | HLDNFSNQIGKHY | Coagulation factor V | Serum | 1571.74809 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2172 | RPWNVASLIYETKGEKNF | Complement component C9 | Serum | 2151.11129 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2173 | WNVASLIYETKGEKNF | Complement component C9 | Serum | 1897.95741 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2174 | NFPSPVDAAF | Hemopexin precursor (Beta-1B-glycoprotein) | Serum | 1063.49746 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2175 | NFPSPVDAAFR | Hemopexin precursor (Beta-1B-glycoprotein) | Serum | 1219.59857 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2176 | KGPGPGGPGGAGVARGGAGGGP | Neurogranin | Serum | 1686.85501 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2177 | GGPGGAGVARGGAGGGP | Neurogranin | Serum | 1250.6116 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2178 | DTEDQEDQVDPRLIDGKMT | Vitamin K-dependent protein C | Serum | 2203.99031 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2179 | DTEDQEDQVDPRLIDGKMTR | Vitamin K-dependent protein C | Serum | 2360.09142 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2180 | DTEDQEDQVDPR | Vitamin K-dependent protein C | Serum | 1445.59065 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2181 | DTEDQEDQVDPRLIDGK | Vitamin K-dependent protein C | Serum | 1971.90214 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2182 | SPNTFAPYPLAGLN | Trinucleotide repeat-containing gene 6C protein | Serum | 1460.72998 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2183 | KDPSQSQSRLPQ | Trinucleotide repeat-containing gene 6C protein | Serum | 1369.69499 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2184 | KVSKQEEASGGPTAPKAESGR | Vasodilator-stimulated phosphoprotein | Serum | 2113.07636 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2185 | EKTPKDESANQEEPEARVPAQ | Vasodilator-stimulated phosphoprotein | Serum | 2352.11935 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2186 | KVSKQEEASGGPTAPKAE | Vasodilator-stimulated phosphoprotein | Serum | 1812.92176 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2187 | SENINHNSAFK | Complement component C6 | Serum | 1259.58946 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2188 | SENINHNSAF | Complement component C6 | Serum | 1131.4945 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2189 | PMGGPPMGQMPGMM | Pre-mRNA-processing factor 40 homolog A | Serum | 1497.54305 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2190 | TYMCIAENRVG | Roundabout homolog 2 | Serum | 1255.56893 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2191 | SLDFTELDVAAEK | Angiotensinogen | Serum | 1436.70349 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2192 | EVQLVESGGGLVQPGGSLR | Ig heavy chain V-III region BRO | Serum | 1880.99559 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2193 | SSPVLDAVPR | Serine/arginine repetitive matrix protein 2 | Serum | 1039.56621 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2194 | TPDVSSALDK | Apolipoprotein C-I | Serum | 1031.5135 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2195 | VKEKLKIDS | Apolipoprotein C-I | Serum | 1058.63356 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2196 | MVTGNPASDEIKRLPGDIQVVPIGVGPNANVQELER | von Willebrand factor | Serum | 3811.98907 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2197 | LPGDIQVVPIGVGPNANVQELER | von Willebrand factor | Serum | 2413.29652 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2198 | MVTGNPASDEIKRLPGDIQVVPIGVGPNANVQELER | von Willebrand factor | Serum | 3827.98399 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2199 | MVTGNPASDEIK | von Willebrand factor | Serum | 1260.602 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2200 | CKDLQL | Collagen alpha-1(V) chain | Serum | 718.36836 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2201 | NNANGVDLNR | Carboxypeptidase N catalytic chain | Serum | 1085.52138 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2202 | TSTTIPT | Mucin-16 | Serum | 719.37013 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2203 | GGPEAAKSDETAA | Heat-shock protein beta-1 | Serum | 1202.54151 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2204 | ESRAQLGGPEAAKSDETAA | Heat-shock protein beta-1 | Serum | 1886.897 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2205 | EGSDDEEEG | Splicing factor 3 subunit 1 | Serum | 965.30978 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2206 | NDLLSATK | Nucleoprotein TPR | Serum | 860.46035 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2207 | GEYDLAGFAVG | Trifunctional purine biosynthetic protein adenosine-3 | Serum | 1097.50294 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2208 | LAENGVR | Receptor-type tyrosine-protein phosphatase N2 | Serum | 757.40825 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2209 | GTNRGASQAGMTG | Transgelin-2 | Serum | 1206.54113 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2210 | NRGASQAGMTGYG | Transgelin-2 | Serum | 1268.55678 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2211 | SSVDELVGIDYSLMKDPVASTSNLDMDFR | Phospholipid transfer protein | Serum | 3203.50025 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2212 | VAPEEHPVLLTEAPLNPK | "Actin, cytoplasmic 1" | Serum | 1953.05713 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2213 | VAAEDWK | Ig alpha-1 chain C region | Serum | 817.39702 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2214 | QEPSQGTTTFAVTSILR | Ig alpha-1 chain C region | Serum | 1834.94249 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2215 | KDTSIMQ | Echinoderm microtubule-associated protein-like 1 | Serum | 821.3953 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2216 | TGIVSGFGRTH | Coagulation factor X | Serum | 1130.58326 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2217 | EMLANTVEKSEGQVDVEK | Ryanodine receptor 2 | Serum | 2020.9623 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2218 | EILESEEKGDPNKPSGFR | PDZ and LIM domain protein 1 | Serum | 2030.9909 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2219 | GIFTDQVLSVLKGEE | Apolipoprotein C-II | Serum | 1633.8563 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2220 | RSEVEAVSLGVP | Alpha-1D adrenergic receptor | Serum | 1241.66157 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2221 | EVQLLESGGGLVQPGGSLR | Ig heavy chain V-III region WAS | Serum | 1895.01124 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2222 | KGHIYQGSEADSVFSGFLIFPSA | Complement C1q subcomponent subunit A | Serum | 2456.20123 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2223 | SLDKFLASVSTVLTSKYR | Hemoglobin subunit alpha | Serum | 2014.10989 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2224 | NEQEQPLGQWHLS | Sulfhydryl oxidase 1 | Serum | 1564.72702 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2225 | VAEYMDWILEKTQSSDGKAQMQSPA | Plasma kallikrein | Serum | 2812.30478 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2226 | SADTLWDIQKDLKDL | L-lactate dehydrogenase B chain | Serum | 1759.89923 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2227 | WLTAVDVP | Forkhead box protein N4 | Serum | 899.47527 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2228 | KDNVEEIQ | Ciliary dynein heavy chain 9 | Serum | 973.47164 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2229 | HLLKLGSPPPHKEA | Switch-associated protein 70 | Serum | 1522.862 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2230 | AASEQHVFK | Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 | Serum | 1015.50869 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2231 | HTGADIHRNGD | Sodium channel protein type 8 subunit alpha | Serum | 1191.5381 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2232 | SEGGFTATGQR | Extracellular matrix protein 1 | Serum | 1109.51015 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2233 | ATLGGPEEESTIENYASRPEAFNTPFLNIDKL | Protein UNQ467/PRO826 | Serum | 3522.71546 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2234 | ASQEAELQL | Ciliary dynein heavy chain 11 | Serum | 987.48729 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2235 | PEPAKSAPAPK | Histone H2B type 1-K | Serum | 1091.59751 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2236 | SAVTTVVNPKYEG | Integrin beta-1 | Serum | 1363.69835 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2237 | RPALNYPVYGETTQV | Proteoglycan-4 | Serum | 1706.86278 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2238 | IPPGASPVSSLSQASSQALAVA | Polyhomeotic-like protein 1 | Serum | 2037.07423 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2239 | DFIKSLK | ATP-binding cassette sub-family A member 6 | Serum | 849.496 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2240 | EAEDEAGMQGPGPRD | Junctophilin-4 | Serum | 1573.63146 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2241 | AGGSWDLAVQER | Carboxypeptidase N subunit 2 | Serum | 1287.62076 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2242 | QQCEAPMEGFQL | Importin subunit alpha-1 | Serum | 1395.57989 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2243 | VVAGVANALAHKYH | Hemoglobin subunit beta | Serum | 1448.78883 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2244 | DEEKMEIQEMQL | Tropomyosin alpha-4 chain | Serum | 1521.6691 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2245 | MLMASPSMED | Cell division cycle and apoptosis regulator protein 1 | Serum | 1110.43955 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2246 | PARGDPGIQGIKG | Collagen alpha-1(XVI) chain | Serum | 1264.68878 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2247 | QVGSGVTTDQVQAEAKESGPTTYK | Ig mu chain C region | Serum | 2480.20308 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2248 | MAGNCLEVLNLGV | PH domain leucine-rich repeat protein phosphatase-like | Serum | 1347.65266 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2249 | CQDLKL | Collagen alpha-2(XI) chain | Serum | 718.36836 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2250 | YAASSYLSLTPEQWK | Ig lambda chain C regions | Serum | 1742.85155 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2251 | ADSSPVKAGVETTTPSKQSNNK | Ig lambda chain C regions | Serum | 2245.11862 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2252 | DKLATFPNGPS | Adenylate cyclase type 3 | Serum | 1145.57169 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2253 | EKPYVCDYCGK | Zinc finger protein 473 | Serum | 1303.55769 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2254 | ALPLDPPPEPAP | Selenoprotein V | Serum | 1212.63904 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2255 | GNWSECSVSCGGGVR | ADAMTS-12 | Serum | 1496.61365 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2256 | EDSGGEASEEEAGAAL | C-jun-amino-terminal kinase-interacting protein 2 | Serum | 1520.61144 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2257 | FDWEAIFDAGTLG | Forkhead box protein J1 | Serum | 1440.65615 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2258 | SLDMDSIIAEVKAQ | "Keratin, type II cytoskeletal 8" | Serum | 1534.75487 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2259 | DGNDHSLWR | Complement C2 | Serum | 1098.48427 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2260 | DGERHAFILQDTK | Factor XIII | Serum | 1528.76341 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2261 | GKGDGCFKDIS | Uncharacterized protein C9orf64 | Serum | 1125.51246 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2262 | EGCGGGGGGGGGGGSGGSGGGG | Homeobox protein Hox-B3 | Serum | 1450.51275 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2263 | GGSGGSGGGGGGGGGGDKSP | Homeobox protein Hox-B4 | Serum | 1417.58181 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2264 | SVPMVPPGIKYLYL | Lumican | Serum | 1575.87347 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2265 | AASGGEDEEEAS | Zinc finger protein 367 | Serum | 1150.42621 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2266 | NAPLHTLVMEVKTT | Cadherin-related tumor suppressor homolog | Serum | 1568.82323 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2267 | AWFLESKDSLL | Apolipoprotein C-IV | Serum | 1307.67615 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2268 | TVKQKPSGSEMEKK | Uncharacterized protein C10orf30 | Serum | 1591.82396 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2269 | MRMLVDLAKSR | Glucose-6-phosphate isomerase | Serum | 1334.71626 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID8669 | VVSLGSPSGEVSHPR | Alpha-2-HS-glycoprotein | Serum | 1505 | MALDI-TOF | Colorectal cancer | Diffrentially expressed | 24618180 |
| CancerPDF_ID8670 | AILVDLE PGTMDSVR | Tubulin beta chain | Serum | 1618 | MALDI-TOF | Colorectal cancer | Diffrentially expressed | 24618180 |
| CancerPDF_ID9450 | RPPGFSPF | Des-Arg9 Bradykinin | Plasma | 904.46 | MALDI-TOF | Colorectal cancer | Higher median intensity for liver metastasis group and lower median intensity for adenoma and CRC groups than the controls. | 26379225 |
| CancerPDF_ID9451 | NA | NA | Plasma | 991.67 | MALDI-TOF | Colorectal cancer | NA | 26379225 |
| CancerPDF_ID9452 | NA | NA | Plasma | 1015.66 | MALDI-TOF | Colorectal cancer | NA | 26379225 |
| CancerPDF_ID9453 | SHALQLNNR | Complement C4-A/Complement C4-B | Plasma | 1052.56 | MALDI-TOF | Colorectal cancer | "Intensity was similar to controls, controversially, in adenoma and CRC groups was highest. " | 26379225 |
| CancerPDF_ID9454 | RPPGFSPFR | Bradykinin | Plasma | 1060.57 | MALDI-TOF | Colorectal cancer | Higher median intensity for liver metastasis group and lower median intensity for adenoma and CRC groups than the controls. | 26379225 |
| CancerPDF_ID9455 | RPPGFSPFR | oxidated Bradykinin | Plasma | 1076.56 | MALDI-TOF | Colorectal cancer | Higher median intensity for liver metastasis group and lower median intensity for adenoma and CRC groups than the controls. | 26379225 |
| CancerPDF_ID9456 | HWESASLLR | Complement C3 | Plasma | 1098.57 | MALDI-TOF | Colorectal cancer | "Lower intensity in control, adenoma, early,late CRC and much more lower in liver metastasis group." | 26379225 |
| CancerPDF_ID9457 | THRIHWESA | Complement C3 | Plasma | 1136.57 | MALDI-TOF | Colorectal cancer | "Expression levels similar for liver metastasis and controls, but for adenoma and CRC groups was higher than controls." | 26379225 |
| CancerPDF_ID9458 | LQLNNRQIR | Complement C4-A/Complement C4-B | Plasma | 1154.68 | MALDI-TOF | Colorectal cancer | "Intensity was similar to controls, controversially, in adenoma and CRC groups was highest. " | 26379225 |
| CancerPDF_ID9459 | IHWESASLLR | Complement C3 | Plasma | 1211.65 | MALDI-TOF | Colorectal cancer | Lower intensity in liver metastasis than control groups and an opposite trend in adenoma and CRC group. | 26379225 |
| CancerPDF_ID9460 | ALQLNNRQIR | Complement C4-A/Complement C4-B | Plasma | 1225.72 | MALDI-TOF | Colorectal cancer | "Intensity was similar to controls, controversially, in adenoma and CRC groups was highest. " | 26379225 |
| CancerPDF_ID9461 | ITHRIHWESA | Complement C3 | Plasma | 1249.65 | MALDI-TOF | Colorectal cancer | "Expression levels similar for liver metastasis and controls, but for adenoma and CRC groups was higher than controls." | 26379225 |
| CancerPDF_ID9462 | MEPLGRQLTSGP | Alpha-2-antiplasmin | Plasma | 1285.66 | MALDI-TOF | Colorectal cancer | Lower intensity in liver metastasis than control groups and an opposite trend in adenoma and CRC group. | 26379225 |
| CancerPDF_ID9463 | RHDWGHEKQR | Kininogen-1 | Plasma | 1348.63 | MALDI-TOF | Colorectal cancer | Not significant in annova test | 26379225 |
| CancerPDF_ID9464 | RIHWESASLLR | Complement C3 | Plasma | 1367.77 | MALDI-TOF | Colorectal cancer | Lower intensity in liver metastasis than control groups and an opposite trend in adenoma and CRC group. | 26379225 |
| CancerPDF_ID9465 | KITHRIHWESA | Complement C3 | Plasma | 1377.72 | MALDI-TOF | Colorectal cancer | "Expression levels similar for liver metastasis and controls, but for adenoma and CRC groups was higher than controls." | 26379225 |
| CancerPDF_ID9466 | GLEEELQFSLGSK | Complement C4-A/Complement C4-B | Plasma | 1436.72 | MALDI-TOF | Colorectal cancer | Lower intensity in liver metastasis than control groups and an opposite trend in adenoma and CRC group. | 26379225 |
| CancerPDF_ID9467 | SHALQLNNRQIR | Complement C4-A/Complement C4-B | Plasma | 1449.77 | MALDI-TOF | Colorectal cancer | Lower intensity in liver metastasis group than adenoma and CRC groups | 26379225 |
| CancerPDF_ID9468 | SKITHRIHWESA | Complement C3 | Plasma | 1464.77 | MALDI-TOF | Colorectal cancer | "Expression levels similar for liver metastasis and controls, but for adenoma and CRC groups was higher than controls." | 26379225 |
| CancerPDF_ID9469 | NGFKSHALQLNNR | Complement C4-A/Complement C4-B | Plasma | 1499.79 | MALDI-TOF | Colorectal cancer | Lower intensity in liver metastasis group than adenoma and CRC groups | 26379225 |
| CancerPDF_ID9470 | RPHFFFPKSRIV | Clusterin | Plasma | 1530.86 | MALDI-TOF | Colorectal cancer | Lower intensity in liver metastasis than control groups and an opposite trend in adenoma and CRC group. | 26379225 |
| CancerPDF_ID9471 | SSKITHRIHWESA | Complement C3 | Plasma | 1551.82 | MALDI-TOF | Colorectal cancer | "Expression levels similar for liver metastasis and controls, but for adenoma and CRC groups was higher than controls." | 26379225 |
| CancerPDF_ID9472 | THRIHWESASLLR | Complement C3 | Plasma | 1605.87 | MALDI-TOF | Colorectal cancer | Lower intensity in liver metastasis than control groups and an opposite trend in adenoma and CRC group. | 26379225 |
| CancerPDF_ID9473 | GPPDVPDHAAYHPFR | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 1675.8 | MALDI-TOF | Colorectal cancer | Lower intensity in liver metastasis than control groups and an opposite trend in adenoma and CRC group. | 26379225 |
| CancerPDF_ID9474 | ITHRIHWESASLLR | Complement C3 | Plasma | 1718.95 | MALDI-TOF | Colorectal cancer | Similar intensity into the case groups. | 26379225 |
| CancerPDF_ID9475 | SKITHRIHWESASLL | Complement C3 | Plasma | 1777.98 | MALDI-TOF | Colorectal cancer | Higher than adenoma and CRC groups | 26379225 |
| CancerPDF_ID9476 | GFKSHALQLNNRQIR | Complement C4-A/Complement C4-B | Plasma | 1782 | MALDI-TOF | Colorectal cancer | Higher intensity in liver metastasis than adenoma and CRC groups. | 26379225 |
| CancerPDF_ID9477 | KITHRIHWESASLLR | Complement C3 | Plasma | 1847.04 | MALDI-TOF | Colorectal cancer | "Low expression in control, adenoma, early,late CRC and much more lower in liver metastasis group." | 26379225 |
| CancerPDF_ID9478 | SSKITHRIHWESASLL | Complement C3 | Plasma | 1865 | MALDI-TOF | Colorectal cancer | Similar intensity into the case groups. | 26379225 |
| CancerPDF_ID9479 | GLEEELQFSLGSKINVK | Complement C4-A/Complement C4-B | Plasma | 1891.02 | MALDI-TOF | Colorectal cancer | "Similar median ion intensity between controls and liver metastasis, and higher median ion intensity for adenoma and CRC groups." | 26379225 |
| CancerPDF_ID9480 | NGFKSHALQLNNRQIR | Complement C4-A/Complement C4-B | Plasma | 1896.03 | MALDI-TOF | Colorectal cancer | "Similar median ion intensity between controls and liver metastasis, and higher median ion intensity for adenoma and CRC groups." | 26379225 |
| CancerPDF_ID9481 | NGFKSHALQLNNRQIR(NH4) | Complement C4-A/Complement C4-B | Plasma | 1913.01 | MALDI-TOF | Colorectal cancer | "Similar median ion intensity between controls and liver metastasis, and higher median ion intensity for adenoma and CRC groups." | 26379225 |
| CancerPDF_ID9482 | SKITHRIHWESASLLR | Complement C3 | Plasma | 1934.07 | MALDI-TOF | Colorectal cancer | "Low expression in control, adenoma, early,late CRC and much more lower in liver metastasis group." | 26379225 |
| CancerPDF_ID9483 | SSKITHRIHWESASLLR | Complement C3 | Plasma | 2021.1 | MALDI-TOF | Colorectal cancer | "Low expression in control, adenoma, early,late CRC and much more lower in liver metastasis group." | 26379225 |
| CancerPDF_ID9484 | SSKITHRIHWESASLLR | Complement C3 | Plasma | 2037.09 | MALDI-TOF | Colorectal cancer | "Expression levels similar for liver metastasis and controls, but for adenoma and CRC groups was higher than controls." | 26379225 |
| CancerPDF_ID9485 | SSKITHRIHWE(Na)SASLLR | Complement C3 | Plasma | 2043.1 | MALDI-TOF | Colorectal cancer | "Expression levels similar for liver metastasis and controls, but for adenoma and CRC groups was higher than controls." | 26379225 |
| CancerPDF_ID9486 | SSKITHRIHWE(K)SASLLR | Complement C3 | Plasma | 2059 | MALDI-TOF | Colorectal cancer | "Expression levels similar for liver metastasis and controls, but for adenoma and CRC groups was higher than controls." | 26379225 |
| CancerPDF_ID9487 | QLGLPGPPDVPDHAAYHPFR | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 2167.08 | MALDI-TOF | Colorectal cancer | Higher intensity in CRC groups vs controls. | 26379225 |
| CancerPDF_ID9488 | QGVNDNEEGFFSARGHRPLD | Fibrinogen beta chain | Plasma | 2228.03 | MALDI-TOF | Colorectal cancer | "Similar median ion intensity between controls and liver metastasis, and higher median ion intensity for adenoma and CRC groups." | 26379225 |
| CancerPDF_ID9489 | KREEAPSLRPAPPPISGGGYR | Fibrinogen beta chain | Plasma | 2235.21 | MALDI-TOF | Colorectal cancer | "Similar median ion intensity between controls and liver metastasis, and higher median ion intensity for adenoma and CRC groups." | 26379225 |
| CancerPDF_ID9490 | QGVNDNEEGFFSARGHRPLDK | Fibrinogen beta chain | Plasma | 2356.13 | MALDI-TOF | Colorectal cancer | "Similar median ion intensity between controls and liver metastasis, and higher median ion intensity for adenoma and CRC groups." | 26379225 |
| CancerPDF_ID9491 | KHNLGHGHKHERDQGHGHQR | Kininogen-1 | Plasma | 2365.22 | MALDI-TOF | Colorectal cancer | "Low expression in control and liver metastatis group as comapred to adenoma, early,late CRC group." | 26379225 |
| CancerPDF_ID9492 | GLEEELQFSLGSKINVKVGGNSK | Complement C4-A/Complement C4-B | Plasma | 2433.3 | MALDI-TOF | Colorectal cancer | "Similar median ion intensity between controls and liver metastasis, and higher median ion intensity for adenoma and CRC groups." | 26379225 |
| CancerPDF_ID9493 | SSSYSKQFTSSTSYNRGDSTFESK | Fibrinogen alpha chain | Plasma | 2681.21 | MALDI-TOF | Colorectal cancer | "Similar median ion intensity between controls and liver metastasis, and higher median ion intensity for adenoma and CRC groups." | 26379225 |