Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID2132 | EPLDDYVNTQGASLFSVTK | Ceruloplasmin | Serum | 2083.01097 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2133 | NNEGTYYSPNYNPQS | Ceruloplasmin | Serum | 1746.71216 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2134 | NNEGTYYSPNYNPQSR | Ceruloplasmin | Serum | 1902.81327 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2135 | KALYLQYTDETF | Ceruloplasmin | Serum | 1490.72931 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2136 | FNKNNEGTYYSPNYNPQS | Ceruloplasmin | Serum | 2135.91846 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2137 | DNEDFQESNR | Ceruloplasmin | Serum | 1252.49562 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2138 | MFTTAPDQVDKEDEDFQESNK | Ceruloplasmin | Serum | 2473.05911 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2139 | LISVDTEHSNIYLQNGPDRIGRLY | Ceruloplasmin | Serum | 2772.41949 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2140 | TYSDHPEKVNKDDEEFIESN | Ceruloplasmin | Serum | 2395.04518 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2992 | AETGDKVYVHL | Ceruloplasmin | Plasma | 1230.6244 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2993 | DNEDFQESNR | Ceruloplasmin | Plasma | 1252.4956 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2994 | KALYLQYTDETF | Ceruloplasmin | Plasma | 1490.7293 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2995 | ALYLQYTDETFR | Ceruloplasmin | Plasma | 1518.7355 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2996 | VNKDDEEFIESNK | Ceruloplasmin | Plasma | 1565.7209 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2997 | GAYPLSIEPIGVRFN | Ceruloplasmin | Plasma | 1631.8671 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2998 | KALYLQYTDETFR | Ceruloplasmin | Plasma | 1646.8304 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2999 | NNEGTYYSPNYNPQSR | Ceruloplasmin | Plasma | 1902.8133 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3000 | NLASRPYTFHSHGITYY | Ceruloplasmin | Plasma | 2025.9697 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3001 | AEEEHLGILGPQLHADVGDK | Ceruloplasmin | Plasma | 2127.0596 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3002 | LISVDTEHSNIYLQNGPDR | Ceruloplasmin | Plasma | 2170.0655 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3003 | KAEEEHLGILGPQLHADVGDKV | Ceruloplasmin | Plasma | 2354.223 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3004 | TYSDHPEKVNKDDEEFIESN | Ceruloplasmin | Plasma | 2395.0452 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3005 | HYYIGIIETTWDYASDHGEK | Ceruloplasmin | Plasma | 2397.0913 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3006 | TYSDHPEKVNKDDEEFIESNK | Ceruloplasmin | Plasma | 2523.1401 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3007 | AEEEHLGILGPQLHADVGDKVKIIF | Ceruloplasmin | Plasma | 2727.4596 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3008 | LISVDTEHSNIYLQNGPDRIGRLY | Ceruloplasmin | Plasma | 2772.4195 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3009 | KEKHYYIGIIETTWDYASDHGEK | Ceruloplasmin | Plasma | 2782.3239 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3010 | KAEEEHLGILGPQLHADVGDKVKIIF | Ceruloplasmin | Plasma | 2855.5545 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3011 | KLISVDTEHSNIYLQNGPDRIGRLY | Ceruloplasmin | Plasma | 2900.5144 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3012 | HRGVYSSDVFDIFPGTYQTLEMFPR | Ceruloplasmin | Plasma | 2961.412 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3013 | NMATRPYSIHAHGVQTESSTVTPTLPGETLTYVW | Ceruloplasmin | Plasma | 3743.8254 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID4459 | CLAKMYYSAVDPTKDIFTGLIGPMKI | Ceruloplasmin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4674 | DQVKDLYSGLIGPLIV | Ceruloplasmin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4753 | EKPVWLGFLGPI | Ceruloplasmin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5553 | IWAEVGDTIRV | Ceruloplasmin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6765 | SAVDPTKDIFTGLIGPMKI | Ceruloplasmin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7299 | SWYLEDNIKTY | Ceruloplasmin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7581 | TVDQVKDLYSGLIGPLIV | Ceruloplasmin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7682 | TYEWTVPKEVGPTNADPV | Ceruloplasmin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8109 | VYRQYTDSTF | Ceruloplasmin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8151 | WLGFLGPIIKAETGDKVYV | Ceruloplasmin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8741 | DDKVYPGEQY | Ceruloplasmin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8829 | FGMGNEVDVHA | Ceruloplasmin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8833 | FLGPIIKAE | Ceruloplasmin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8879 | GLIGPLIVCR | Ceruloplasmin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9188 | QRADDKVYPGEQ | Ceruloplasmin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9189 | QRADDKVYPGEQY | Ceruloplasmin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9193 | QSPGEGDGNCVTRIY | Ceruloplasmin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9194 | QSPGEGDGNCVTRIYH | Ceruloplasmin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9254 | SPGEGDGNCVTRIY | Ceruloplasmin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9255 | SPGEGDGNCVTRIYH | Ceruloplasmin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9336 | TVDQVKDLYS | Ceruloplasmin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9392 | VNKDDEEFIES | Ceruloplasmin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9393 | VNKDDEEFIESN | Ceruloplasmin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID10313 | FHGQALTNKNYRIDT | Ceruloplasmin | Urine | 1777.8972 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10505 | YIGSKYKKVVYRQYTDST | Ceruloplasmin | Urine | 2199.1384 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10615 | HTVHFHGHSFQYKHRGVYSSDV | Ceruloplasmin | Urine | 2625.2474 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10636 | LHTVHFHGHSFQYKHRGVYSSDV | Ceruloplasmin | Urine | 2738.3413 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID13673 | TVDQVKDLY | Ceruloplasmin | Plasma | 1080.558 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |