Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID128 | ISRIKQSEL | Apolipoprotein C-I | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID129 | FQKVKEKLKIDS | Apolipoprotein C-I | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID759 | REWFSETFQK | Apolipoprotein C-I | Plasma | 679.32 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID760 | REWFSETFQ | Apolipoprotein C-I | Plasma | 615.28 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID761 | TPDVSSALDKL | Apolipoprotein C-I | Plasma | 573.3 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID762 | DVSSALDKLKEFGNTLEDK | Apolipoprotein C-I | Plasma | 703.69 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID763 | DVSSALDKLKEFGN | Apolipoprotein C-I | Plasma | 761.88 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID764 | DVSSALDKLKEF | Apolipoprotein C-I | Plasma | 676.35 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID765 | DVSSALDKL | Apolipoprotein C-I | Plasma | 474.25 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID1082 | DVSSALDKLKEFGNTLEDKARELIS | Apolipoprotein C-I | Serum | 2778.15 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID2194 | TPDVSSALDK | Apolipoprotein C-I | Serum | 1031.5135 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2195 | VKEKLKIDS | Apolipoprotein C-I | Serum | 1058.63356 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID3188 | DVSSALDK | Apolipoprotein C-I | Plasma | 833.4131 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3189 | TPDVSSALDK | Apolipoprotein C-I | Plasma | 1031.5135 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3190 | VKEKLKIDS | Apolipoprotein C-I | Plasma | 1058.6336 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3191 | REWFSETFQ | Apolipoprotein C-I | Plasma | 1228.5513 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3192 | LKEFGNTLEDK | Apolipoprotein C-I | Plasma | 1292.6612 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3193 | MREWFSETFQ | Apolipoprotein C-I | Plasma | 1359.5918 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3194 | MREWFSETFQK | Apolipoprotein C-I | Plasma | 1487.6867 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3195 | MREWFSETFQKV | Apolipoprotein C-I | Plasma | 1586.7552 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3196 | ARELISRIKQSELSA | Apolipoprotein C-I | Plasma | 1699.9581 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3197 | DVSSALDKLKEFGNTLEDK | Apolipoprotein C-I | Plasma | 2108.0637 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3198 | LKEFGNTLEDKARELISR | Apolipoprotein C-I | Plasma | 2118.1433 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3199 | TPDVSSALDKLKEFGNTLEDK | Apolipoprotein C-I | Plasma | 2306.1642 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3265 | NA | Apolipoprotein C-I | Serum | 6431 | MALDI-TOF | Stomach adenocarcinoma | Differentially expressed in cancer patients as cpmpare to normal | 21267442 |
| CancerPDF_ID3266 | NA | Apolipoprotein C-I | Serum | 6629 | MALDI-TOF | Stomach adenocarcinoma | Differentially expressed in cancer patients as cpmpare to normal | 21267442 |
| CancerPDF_ID4242 | ALDKLKEFGNTLEDKARELI | Apolipoprotein C-I | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8610 | FQKVKEKLKIDS | Apolipoprotein CI | Serum | 1461.86 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8618 | TPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS | Apolipoprotein C-I precursor | Serum | 6625.91 | MALDI-TOF | Breast cancer | Downregulated in cancer as compare to normal control with fold change of 1.5 | 26705257 |
| CancerPDF_ID8780 | DVSSALDKLKEF | Apolipoprotein C-I | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9573 | TPDVSSALDKLKEFGN | Apolipoprotein C-I | Serum | 574.28 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID10501 | ALDKLKEFGNTLEDKAREL | Apolipoprotein C-I | Urine | 2190.1716 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10606 | DVSSALDKLKEFGNTLEDKAREL | Apolipoprotein C-I | Urine | 2578.3322 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10643 | TPDVSSALDKLKEFGNTLEDKAREL | Apolipoprotein C-I | Urine | 2776.4278 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |