Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
---|---|---|---|---|---|---|---|---|
CancerPDF_ID11051 | NRIPESGGDNSVFDIFELTGAARKGSGR | Thrombospondin-1 | Serum | 2950.6 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Upregulated in patients vs normal with mean intensity 84.95 in control and 666.08 in cancer | 26993605 |
CancerPDF_ID11052 | SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Serum | 5900 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Upregulated in patients vs normal with mean intensity 100.55 in normal and 831.12 in cancer | 26993605 |
CancerPDF_ID11053 | MGVVSLGSPSGEVSHPRKT | Alpha2-HS glycoprotein | Serum | 1925.5 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Downregulated in patients vs normal with mean intensity in cancer 149.51 and mean intensity in normal as 590.32 | 26993605 |
CancerPDF_ID11054 | SSYSKQFTSSTSYNRGDST | Fibrinogen alpha chain | Serum | 2102.7 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Upregulated in ESCC patients vs control with mean intensity in cancer as 532.28 and mean intensity in control as 266.24 | 26993605 |
CancerPDF_ID11055 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | ITIH4 | Serum | 3273 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Downregulated in ESCC patients vs control with mean intensity in cancer 221.86 and mean intensity in normal 764.46 | 26993605 |
CancerPDF_ID11056 | SYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Serum | 3239.9 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Upregulated in ESCC patients vs control with mean intensity in cancer as 831.12 and mean intensity in control as 100.55 | 26993605 |
CancerPDF_ID11057 | LTKKFSRHHGPTITAKL | AMBP | Serum | 1935.9 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | "Downregulated in ESCC patients vs control with mean intensity in cancer 1018.23 and mean intensity in normal 2,456.36in normal" | 26993605 |
CancerPDF_ID11058 | NVHSGSTFFKYYLQGAKIPKPEAS | ITIH4 | Serum | 2669.1 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Upregulated in ESCC patients vs control with mean intensity in cancer 417.72 and mean intensity in normal 190.00 | 26993605 |
CancerPDF_ID11059 | QLGLPGPPDVPDHAAYHPF | ITIH4 | Serum | 2026.8 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | "Upregulated in ESCC patients vs control with mean intensity in cancer as 2,730.99 and mean intensity in normal 1,290.54" | 26993605 |
CancerPDF_ID11060 | CSRDNTLKVIDLR | isoform CRA_b | Serum | 1532.1 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | "Upregulated in ESCC patients vs control with mean intensity in cancer as 1,022.00 and mean intensity in normal as 527.84" | 26993605 |
CancerPDF_ID11061 | NA | NA | Serum | 5924.6 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Upregulated in ESCC patients vs control with mean intensity in cancer as 425.63 and mean intensity in normal as 50.61 | 26993605 |
CancerPDF_ID11062 | NA | NA | Serum | 5910 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Upregulated in ESCC patients vs control with mean intensity in cancer as 739.57 and mean intensity in normal as 87.40 | 26993605 |
CancerPDF_ID11063 | NA | NA | Serum | 5882.1 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Upregulated in ESCC patients vs control with mean intensity in cancer as 681.97 and mean intensity in normal as 114.65 | 26993605 |
CancerPDF_ID11064 | NA | NA | Serum | 4209.6 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Upregulated in ESCC patients vs control with mean intensity in cancer as 1772.59 and mean intensity in normal as 696.17 | 26993605 |
CancerPDF_ID11065 | NA | NA | Serum | 4199.6 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Upregulated in ESCC patients vs control with mean intensity in cancer as 1767.14 and mean intensity in normal as 867.09 | 26993605 |
CancerPDF_ID11066 | NA | NA | Serum | 4225.6 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Upregulated in ESCC patients vs control with mean intensity in cancer as 526.85 and mean intensity in normal as224.98 | 26993605 |
CancerPDF_ID11067 | NA | NA | Serum | 3883.6 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Upregulated in ESCC patients vs control | 26993605 |
CancerPDF_ID11068 | NA | NA | Serum | 3249.2 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Upregulated in ESCC patients vs control | 26993605 |
CancerPDF_ID11069 | NA | NA | Serum | 4086.1 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Upregulated in ESCC patients vs control | 26993605 |
CancerPDF_ID11070 | NA | NA | Serum | 3264.9 | MALDI-TOF | Esophageal squamous cell carcinoma (ESCC) | Downregulated in ESCC patients vs control with mean intensity in cancer and mean intensity in normal | 26993605 |