Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID11033 | KEDIDTSSKGGCVQ | RNA-binding protein 6 | Serum | 1466.98 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11034 | AILVDLEPGTMDSVR | tubulin beta chain | Serum | 1618.22 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11035 | IHTGENPYECSECGKAFRYSSALVRHQRIHTGEKPLNGIGMSKSSLRVTTELN | zinc finger protein 3 | Serum | 5905.23 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11036 | NA | NA | Serum | 1866.63 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11037 | NA | NA | Serum | 3317 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11038 | NA | NA | Serum | 6433.36 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11039 | NA | NA | Serum | 1780.1 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11040 | NA | NA | Serum | 1061.34 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11041 | NA | NA | Serum | 5752.25 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11042 | NA | NA | Serum | 5724.76 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11043 | NA | NA | Serum | 5844.36 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11044 | NA | NA | Serum | 5739.69 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11045 | NA | NA | Serum | 5818.83 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11046 | NA | NA | Serum | 4091.86 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11047 | NA | NA | Serum | 1714.57 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11048 | NA | NA | Serum | 1981.69 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11049 | NA | NA | Serum | 1077.14 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11050 | NA | NA | Serum | 1547 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |