Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
---|---|---|---|---|---|---|---|---|
CancerPDF_ID3401 | SWGGRPQRMGAVPGGVWSAVLMGGAR | Receptor tyrosine-protein kinase erbB-2 | Plasma | NA | Linear ion-trap mass spectrometer (LTQ) coupled with a Surveyor HPLC-MS | Breast cancer | Differentially expressed between normal and patients | 24565027 |
CancerPDF_ID3402 | QTPKHISESLGAEVDPDMSWSSSLATPPTLSSTVLIGLLHSSVK | Breast cancer type 2 susceptibility protein | Plasma | NA | Linear ion-trap mass spectrometer (LTQ) coupled with a Surveyor HPLC-MS | Breast cancer | Differentially expressed between normal and patients | 24565027 |
CancerPDF_ID3403 | SLWLQSQPHFCCFWLTVTFPPPLQTHRELAQSSHAQR | NT-3 growth factor receptor | Plasma | NA | Linear ion-trap mass spectrometer (LTQ) coupled with a Surveyor HPLC-MS | Breast cancer | Differentially expressed between normal and patients | 24565027 |
CancerPDF_ID3404 | WGLLLALLPPGAASTQAVWTWMTR | Receptor tyrosine-protein kinase erbB-2 | Plasma | NA | Linear ion-trap mass spectrometer (LTQ) coupled with a Surveyor HPLC-MS | Breast cancer | Differentially expressed between normal and patients | 24565027 |
CancerPDF_ID3405 | LSWNHVARALTLTQSLVSSVTSGK | NT-3 growth factor receptor | Plasma | NA | Linear ion-trap mass spectrometer (LTQ) coupled with a Surveyor HPLC-MS | Breast cancer | Differentially expressed between normal and patients | 24565027 |
CancerPDF_ID3406 | CQGEPYHDIRFNLMAVVPDR | Ubiquitin carboxyl-terminal hydrolase BAP1 | Plasma | NA | Linear ion-trap mass spectrometer (LTQ) coupled with a Surveyor HPLC-MS | Breast cancer | Differentially expressed between normal and patients | 24565027 |
CancerPDF_ID3407 | QVLPVGVLGPPGQQAPPPYPGPHPAGPPVIQQPTTPMFVAPPPK | Protein polybromo-1 | Plasma | NA | Linear ion-trap mass spectrometer (LTQ) coupled with a Surveyor HPLC-MS | Breast cancer | Differentially expressed between normal and patients | 24565027 |
CancerPDF_ID3408 | DHLACWDYDLCITCYNTKNHDHK | Histone acetyltransferase p300 | Plasma | NA | Linear ion-trap mass spectrometer (LTQ) coupled with a Surveyor HPLC-MS | Breast cancer | Differentially expressed between normal and patients | 24565027 |