Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID162 | NDNEEGFFSAR | Fibrinopeptide B | Serum | 1129.4849 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS | 19728888 |
| CancerPDF_ID163 | NA | NA | Serum | 1183.5995 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID164 | NA | NA | Serum | 1201.5663 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID165 | GEGDFLAEGGGVR | Fibrinopeptide A | Serum | 1263.5958 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS | 19728888 |
| CancerPDF_ID166 | NA | NA | Serum | 1288.6006 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID168 | SGEGDFLAEGGGVR | Fibrinopeptide A | Serum | 1350.6275 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID169 | NA | NA | Serum | 1389.6433 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID170 | NA | NA | Serum | 1402.671 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID174 | NA | NA | Serum | 1445.5828 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID175 | NA | NA | Serum | 1447.6855 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID179 | NA | NA | Serum | 1460.6257 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID180 | NA | NA | Serum | 1477.6539 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID181 | NA | NA | Serum | 1479.6646 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID182 | NA | NA | Serum | 1487.6226 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID183 | NA | NA | Serum | 1491.6634 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID185 | NA | NA | Serum | 1503.5994 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID186 | NA | NA | Serum | 1507.6643 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID187 | ADSGEGDFLAEGGGVR | fibrinopeptide A; | Serum | 1536.6906 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS | 19728888 |
| CancerPDF_ID188 | EGVNDNEEGFFSA | Glu-1-fibrinopeptide B; | Serum | 1552.669 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS | 19728888 |
| CancerPDF_ID190 | NA | NA | Serum | 1569.6823 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID191 | NA | NA | Serum | 1573.7005 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID193 | NA | NA | Serum | 1630.6679 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID196 | SKITHRIHWESASLL | Complement C3f | Serum | 1777.966 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Peptide Ion Signature for differentiation between Short PFS(Progression Free survival) versus long PFS | 19728888 |
| CancerPDF_ID201 | NA | NA | Serum | 2743.4663 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID202 | NA | NA | Serum | 2747.4349 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | "Differentially expressed between pre-treatment, after two cycles of treatment vs end of treatment" | 19728888 |
| CancerPDF_ID224 | NA | NA | Serum | 987.5905 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID225 | ADSGEGDFLAEGGGVR | Phospho-fibrinopetide A | Serum | 1616.6366 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID226 | SPMYSIITPNILRLESEETM | Complement C3 beta/f | Serum | 2324.1475 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Signature peptide that can Differentiate between NSCLC patients and healthy volunteers | 19728888 |
| CancerPDF_ID227 | NA | NA | Serum | 2104.998 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID228 | NA | NA | Serum | 2153.0655 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID229 | NA | NA | Serum | 1450.4893 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID230 | SPMYSIITPNILRLESEET | Complement C3 beta/f | Serum | 2193.1036 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Signature peptide that can Differentiate between NSCLC patients and healthy volunteers | 19728888 |
| CancerPDF_ID231 | NA | NA | Serum | 898.4169 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID232 | NA | NA | Serum | 3427.8221 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID233 | NA | NA | Serum | 2163.9817 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID234 | NA | NA | Serum | 1670.5947 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID235 | NA | NA | Serum | 2099.1139 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID236 | NA | NA | Serum | 1456.5093 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID237 | NA | NA | Serum | 1418.539 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID238 | NA | NA | Serum | 1630.6679 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID239 | NA | NA | Serum | 2228.0362 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID240 | NA | NA | Serum | 2209.0934 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients vs healthy volunteers | 19728888 |
| CancerPDF_ID241 | VLSPADKTNVKAAWGKVGAHAGEYGAEALERM | Hemoglobin alpha | Serum | 3326.6863 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Signature peptide that can Differentiate between NSCLC patients and healthy volunteers | 19728888 |
| CancerPDF_ID258 | NA | NA | Serum | 2215.2849 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients with a partial response versus patients with stable or progressive disease | 19728888 |
| CancerPDF_ID263 | NA | Fibrinopeptide A | Serum | 1616.6366 | MALDI-TOF | "Non-small cell lung cancer (NSCLC) patients, who were treated with first-line chemotherapy" | Differentially expressed between NSCLC patients with a partial response versus patients with stable or progressive disease | 19728888 |
| CancerPDF_ID1007 | NA | NA | Serum | 5636.48 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1010 | NA | NA | Serum | 4248.84 | MALDI-TOF | Colorectal cancer | Downregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1018 | NA | NA | Serum | 2046.31 | MALDI-TOF | Colorectal cancer | Upregulated in cancer vs normal | 23091368 |
| CancerPDF_ID1060 | GLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 1786.86 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =2.39, 2.88 and 2.3 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID3524 | KLGHPDTL | Protein S100-A9 | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3525 | NA | NA | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3527 | NA | NA | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3528 | YQTNKAKH | Cystatin-B | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3529 | NA | NA | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3532 | SpGPDGKTGpP | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3535 | RYVGGQEHF | Alpha-1-acid glycoprotein 1 | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3538 | SAYQEAMDIS | "14-3-3 protein sigma, SFN" | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3540 | DGESGRpGRpG | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3547 | NA | NA | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3561 | SpGSpGPDGKTGPp | Collagen alpha1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3566 | GLpGPpGERGGpGS | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3570 | NA | NA | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3573 | GpPGEGLPGPpGpPGS | Collagen alpha-1(XVII) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3576 | ERAEDEEEINAE | Myosin-3 | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3582 | SQDASDGLQRLHM | Endothelial protein C receptor | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3593 | GLpGpPGSNGNPGPpGp | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3599 | DEPPQSPWDRVKD | Apolipoprotein A-I | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3610 | VLTGYQVDKNKDDE | Cystatin-A | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3614 | GSSVGTGTNLHSESASF | Serine/threonine-protein kinase D1 | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3615 | LSALEEYTKKLNTQ | Apolipoprotein A-I | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3620 | TGDAGpVGPpGPpGPPGPP | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3623 | GNSGEpGApGSKGDTGAKG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3626 | DHDVGSELPPEGVLGAL | ProSAAS | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3627 | GPpGLDGQPGAPGLpGPPG | Collagen alpha-5(IV) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3629 | EpGSPGENGApGQMGPRG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3630 | NA | NA | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3633 | GPpGPTGPGGDKGDTGPpGP | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3634 | NA | NA | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3637 | EpGSpGENGApGQmGPRG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3640 | QGPGGPpGPKGNSGEpGApG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3644 | GMEPQVPFSDYMELQ | Zinc finger protein basonuclin-1 | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3646 | EEAPSLRPAPPPISGGGY | Fibrinogen beta chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3647 | NDGARGSDGQPGPPGppGT | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3649 | IGTYCGQPVCENGCQNGG | "Fibrillin-2, FBN2" | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3650 | GEpGSpGENGApGQMGPRG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3652 | GEpGSpGENGApGQMGPRG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3663 | GpEGAQGPRGEpGTPGSpGP | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3665 | NpGPPGpSGSpGKDGPpGPAG | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3666 | NSGEpGApGSKGDTGAKGEp | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3672 | ADLADGVSGGEGKGGSDGGGSH | "CD99 antigen, CD99" | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3690 | AVEPDRRNQSPVDQGATGA | Syndecan-1 | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3691 | NA | NA | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3697 | PDGGLVVLSGGGTSGRMAFLm | Glucokinase regulatory protein | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3699 | NA | NA | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3700 | GTDVKDIPFNLTNNIPGCE | Coiled-coil domain-containing protein 144B | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3708 | NA | NA | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3711 | NA | NA | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3713 | GpTGpIGPpGpAGQPGDKGEGGAP | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3725 | ANGApGNDGAKGDAGApGApGSQGAPG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3726 | TFVCPTEIVAFSDKANEFHD | "Thioredoxin-dependent peroxide reductase, mitochondrial" | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3739 | NA | NA | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3742 | KGNSGEpGAPGSKGDTGAKGEpGpVG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3744 | KGNSGEpGApGSKGDTGAKGEpGpVG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3746 | SGNAGPpGPPGPAGKEGGKGpRGETGP | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3749 | TQQPQQDEMPSPTFLTQVKES | Apolipoprotein C-IV | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3755 | DEAGSEADHEGTHSTKRGHAKSRP | "Fibrinogen alpha chain, Fibrinogen alpha chain" | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3763 | NA | NA | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3764 | DEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3765 | NA | NA | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3768 | NA | NA | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3769 | SQYLSSVDSFGSPPTAAASQETDQLE | Protein fosB | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3771 | AVADTRDQADGSRASVDSGSSEEQGGSS | Polymeric immunoglobulin receptor | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3774 | GPPGESGREGApGAEGSPGRDGSPGAKGDR | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3784 | SPGIPGSKGEqGFmGpPGPqGQPGLPGSPGHAT | Collagen alpha-1(IV) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3785 | NA | NA | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3793 | NA | NA | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3797 | PRGERGpQGNSGEKGDQGFQGQPGFPGpPGPpG | Collagen alpha-1(XVI) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3799 | NA | NA | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3800 | VLSPADKTNVKAAWGKVGAHAGEYGAEALERm | Hemoglobin subunit alpha | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3801 | NA | NA | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3804 | PpGPAGFAGPPGADGQPGAKGEpGDAGAKGDAGPPGPAGP | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3806 | VLSPADKTNVKAAWGKVGAHAGEYGAEALERm | Hemoglobin subunit alpha | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3810 | FAGpPGADGQPGAKGEpGDAGAKGDAGPpGPAGPAGPpGPIG | Collagen alpha-1(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3820 | SNGNpGPPGPSGSPGKDGPPGpAGNTGApGSpGVSGPKGDAGQPG | Collagen alpha-1(III) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3826 | NA | NA | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3839 | NA | NA | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3848 | NA | NA | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID9585 | TVGSLAGQPLQERAQAWGERL | Apolipoprotein E | Serum | 756.38 | LC-MS | Lung adenocarcinoma | Differentially expressed between Lung cancer vs control | 21533267 |
| CancerPDF_ID11103 | NA | NA | Urine | 1219.1 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in pT1b compared to pT1a patients | 26482227 |
| CancerPDF_ID11105 | NA | NA | Urine | 4366.9 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in pT1b compared to pT1a patients | 26482227 |
| CancerPDF_ID11107 | NA | NA | Urine | 4751.5 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in pT1b compared to pT1a patients | 26482227 |
| CancerPDF_ID11109 | NA | NA | Urine | 6237.8 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in pT1b compared to pT1a patients | 26482227 |
| CancerPDF_ID11121 | NA | NA | Urine | 1755.8 | MALDI-TOF | Clear cell renal carcinoma | Upregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID11123 | NA | NA | Urine | 1912.1 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID11127 | NA | NA | Urine | 4026.9 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID11133 | NA | NA | Urine | 6261.4 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID12693 | VSFLSALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 1970.984 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.57 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.88, Upregulated in BC vs healthy with 0.925 fold change" | 27058005 |
| CancerPDF_ID12696 | IHWESASLL | Complement C3 | Serum | 1055.082 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.21 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.27, Upregulated in BC vs healthy with 1.126 fold change" | 27058005 |
| CancerPDF_ID12701 | THRIHWESASLL | Complement C3 | Serum | 1449.804 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.52 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.25, Upregulated in BC vs healthy with 1.134 fold change" | 27058005 |
| CancerPDF_ID12709 | SSKITHRIHWESASLLR | Complement C3 | Serum | 2021.146 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.02 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.19, Upregulated in BC vs healthy with 1.844 fold change" | 27058005 |
| CancerPDF_ID12710 | GFKSHALQLNNRQI | Complement C4 | Serum | 1625.946 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.68 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.78, Upregulated in BC vs healthy with 0.763 fold change" | 27058005 |
| CancerPDF_ID12715 | HFFFPK | Clusterin | Serum | 822.485 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.31 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.10, Upregulated in BC vs healthy with 1.029 fold change" | 27058005 |
| CancerPDF_ID12716 | FPKSRIV | Clusterin | Serum | 846.533 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.50 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.21, Upregulated in BC vs healthy with 1.139 fold change" | 27058005 |
| CancerPDF_ID12720 | FLAEGGGVR | Fibrinogen alpha chain | Serum | 905.065 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.28 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.35, Upregulated in BC vs healthy with 1.203 fold change" | 27058005 |
| CancerPDF_ID12721 | SSSYSKQFTSSTS | Fibrinogen alpha chain | Serum | 1396.795 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.57 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.01, Upregulated in BC vs healthy with 0.963 fold change" | 27058005 |
| CancerPDF_ID12722 | NRGDSTFESKSYKM | Fibrinogen alpha chain | Serum | 1665.957 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.65 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.06, Upregulated in BC vs healthy with 1.083 fold change" | 27058005 |
| CancerPDF_ID12725 | SSSYSKQFTSSTSYNRGDSTFESKS | Fibrinogen alpha chain | Serum | 2768.32 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.35 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.18, Upregulated in BC vs healthy with 1.074 fold change" | 27058005 |
| CancerPDF_ID12728 | SSSYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha chain | Serum | 3206.443 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.44 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.05, Upregulated in BC vs healthy with 0.958 fold change" | 27058005 |
| CancerPDF_ID12729 | SSSYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha chain | Serum | 3277.592 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.43 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.11, Upregulated in BC vs healthy with 0.942 fold change" | 27058005 |
| CancerPDF_ID12730 | QAGAAGSRMNFRPGVLS | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 1717.941 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.91 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.93, Upregulated in BC vs healthy with 1.276 fold change" | 27058005 |
| CancerPDF_ID12732 | YLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 1889.031 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.14 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.08, Upregulated in BC vs healthy with 1.244 fold change" | 27058005 |
| CancerPDF_ID12735 | NVHSGSTFFKYYLQGAKIPKPEA | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 2582.393 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.38 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.62, Upregulated in BC vs healthy with 0.975 fold change" | 27058005 |
| CancerPDF_ID12738 | NVHSGSTFFKYYLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 3156.679 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.52 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.11, Upregulated in BC vs healthy with 1.158 fold change" | 27058005 |
| CancerPDF_ID12739 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 3272.752 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.42 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.89, Upregulated in BC vs healthy with 1.036 fold change" | 27058005 |
| CancerPDF_ID12740 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 3288.759 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.34 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.85, Upregulated in BC vs healthy with 1.126 fold change" | 27058005 |
| CancerPDF_ID12741 | QAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 3969.989 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.57 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.82, Upregulated in BC vs healthy with 1.170 fold change" | 27058005 |
| CancerPDF_ID12742 | RPPGFSPF | Kininogen-1 | Serum | 904.5017 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.29 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.40, Upregulated in BC vs healthy with 0.902 fold change" | 27058005 |
| CancerPDF_ID12745 | HGHKHERDQGHGHQ | Kininogen-1 | Serum | 1659.808 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.47 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.65, Upregulated in BC vs healthy with 1.231 fold change" | 27058005 |
| CancerPDF_ID12746 | GHGHKHERDQGHGHQ | Kininogen-1 | Serum | 1716.955 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.25 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.11, Upregulated in BC vs healthy with 1.154 fold change" | 27058005 |
| CancerPDF_ID12749 | HNLGHGHKHERDQGHGHQ | Kininogen-1 | Serum | 2081.006 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.43 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.71, Upregulated in BC vs healthy with 1.565 fold change" | 27058005 |
| CancerPDF_ID12752 | KHNLGHGHKHERDQGHGHQR | Kininogen-1 | Serum | 2365.208 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.62 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.87, Upregulated in BC vs healthy with 1.340 fold change" | 27058005 |
| CancerPDF_ID12777 | NA | NA | Serum | 9359.98 | MALDI-TOF | Hepatocellular carcinoma | Downregulated in cancer vs Healthy | 25910294 |
| CancerPDF_ID12778 | NA | NA | Serum | 4965.18 | MALDI-TOF | Hepatocellular carcinoma | Downregulated in cancer vs Healthy | 25910294 |
| CancerPDF_ID12779 | NA | NA | Serum | 6636.05 | MALDI-TOF | Hepatocellular carcinoma | Downregulated in cancer vs Healthy | 25910294 |
| CancerPDF_ID12780 | NA | NA | Serum | 1082.55 | MALDI-TOF | Hepatocellular carcinoma | Upregulated in cancer vs Healthy | 25910294 |
| CancerPDF_ID12781 | NA | NA | Serum | 4272.16 | MALDI-TOF | Hepatocellular carcinoma | Downregulated in cancer vs Healthy | 25910294 |
| CancerPDF_ID12782 | NA | NA | Serum | 9524.77 | MALDI-TOF | Hepatocellular carcinoma | Downregulated in cancer vs Healthy | 25910294 |
| CancerPDF_ID12783 | NA | NA | Serum | 2510.81 | MALDI-TOF | Hepatocellular carcinoma | Downregulated in cancer vs Healthy | 25910294 |
| CancerPDF_ID12784 | NA | NA | Serum | 2354.46 | MALDI-TOF | Hepatocellular carcinoma | Upregulated in cancer vs Healthy | 25910294 |
| CancerPDF_ID12787 | NA | NA | Serum | 760.4 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12791 | NA | NA | Serum | 5906.51 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12793 | NA | NA | Serum | 2662.1 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12795 | NA | NA | Serum | 810.84 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12796 | NA | NA | Serum | 4094.16 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12798 | NA | NA | Serum | 811.68 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12803 | NA | NA | Serum | 3242.81 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12806 | NA | NA | Serum | 2953.91 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12808 | NA | NA | Serum | 4645.79 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12810 | NA | NA | Serum | 5338.47 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12814 | NA | NA | Serum | 2864.56 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12815 | NA | NA | Serum | 4972.38 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12817 | NA | NA | Serum | 3952.11 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12818 | NA | NA | Serum | 3955.46 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12819 | NA | NA | Serum | 4057.53 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12820 | NA | NA | Serum | 4055.44 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12827 | NA | NA | Serum | 1779.76 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12830 | NA | NA | Serum | 2933.65 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12831 | NA | NA | Serum | 2935.22 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12832 | NA | NA | Serum | 4078.95 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12833 | NA | NA | Serum | 4075.52 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12835 | NA | NA | Serum | 2646.38 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12836 | NA | NA | Serum | 4175.08 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12837 | NA | NA | Serum | 3938.59 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12838 | NA | NA | Serum | 2740.65 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12840 | NA | NA | Serum | 4160 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12841 | NA | NA | Serum | 5073.04 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12843 | NA | NA | Serum | 4253.52 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12861 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12872 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12881 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Downregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12884 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Upregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12890 | NA | NA | Serum | NA | MALDI-TOF | Acute myeloid leukemia (AML) | Upregulated in AML vs healthy | 23915341 |
| CancerPDF_ID12893 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Upregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12894 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Upregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12895 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Downregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12898 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Upregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12899 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Upregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12900 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Downregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12904 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Downregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12908 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Downregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID12909 | NA | NA | Serum | NA | MALDI-TOF | Breast cancer | Upregulated in breast cancer patients vs healthy | 22521044 |
| CancerPDF_ID14075 | NA | NA | Serum | 1498.44 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14087 | NA | NA | Serum | 1589.31 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14098 | NA | NA | Serum | 1699.85 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14101 | NA | NA | Serum | 1738.52 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14106 | NA | NA | Serum | 1797.47 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14112 | NA | NA | Serum | 1883.63 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14113 | NA | NA | Serum | 1899.32 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14114 | NA | NA | Serum | 1905.69 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14118 | NA | NA | Serum | 1944.57 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14132 | NA | NA | Serum | 2087.4 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14144 | NA | NA | Serum | 2236.48 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14151 | NA | NA | Serum | 2302.52 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14166 | NA | NA | Serum | 2568.39 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14176 | NA | NA | Serum | 2695.37 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14184 | NA | NA | Serum | 2810.41 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14185 | NA | NA | Serum | 2830.42 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14198 | NA | NA | Serum | 3177.41 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14204 | NA | NA | Serum | 3243.83 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14217 | NA | NA | Serum | 3409.35 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14218 | NA | NA | Serum | 3458.93 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14219 | NA | NA | Serum | 3478.14 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14223 | NA | NA | Serum | 3706.99 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14235 | NA | NA | Serum | 4060.17 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14240 | NA | NA | Serum | 4149.54 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14243 | NA | NA | Serum | 4208.25 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14265 | NA | NA | Serum | 4968.92 | MALDI-TOF | Gastric cancer | Downregulated in cancer vs healthy | 26376850 |
| CancerPDF_ID14269 | NA | NA | Serum | 5026.15 | MALDI-TOF | Gastric cancer | Upregulated in cancer vs healthy | 26376850 |