Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID822 | NEQEQPLGQWHLS | Sulfhydryl oxidase 1 | Plasma | 783.36 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | "Uniquely present in 16/23 patients, absent in normal" | 19795908 |
| CancerPDF_ID823 | AAPGQEPPEHMAELQR | Sulfhydryl oxidase 1 | Plasma | 880.91 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | "Uniquely present in 16/23 patients, absent in normal" | 19795908 |
| CancerPDF_ID1111 | NA | Platelet factor 4 | Serum | 3884 | MALDI-TOF | Pancreatic cancer | Differentially expressed between cancer vs normal and considered as signature ion | 19470732 |
| CancerPDF_ID3337 | NA | NA | Serum | 1546.43 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3338 | NA | NA | Serum | 7763.24 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3339 | NA | NA | Serum | 2883.76 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3340 | NA | NA | Serum | 2093.19 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3341 | NA | NA | Serum | 7563.83 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3342 | NA | NA | Serum | 6047.64 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3343 | NA | NA | Serum | 7920.5 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3344 | NA | NA | Serum | 8139.21 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3345 | NA | NA | Serum | 2932.99 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3346 | NA | NA | Serum | 1887.15 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3347 | NA | NA | Serum | 1897.93 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3348 | NA | NA | Serum | 3883.45 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3349 | NA | NA | Serum | 1741.38 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3350 | NA | NA | Serum | 3952.19 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3351 | NA | NA | Serum | 7468.37 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3352 | NA | NA | Serum | 5292.77 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3353 | NA | NA | Serum | 5079.68 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3354 | NA | NA | Serum | 1350.83 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3355 | NA | NA | Serum | 2554.64 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3356 | NA | NA | Serum | 4529.7 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3357 | NA | NA | Serum | 1012.61 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3358 | NA | NA | Serum | 1519.98 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3359 | NA | NA | Serum | 1945.53 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3360 | NA | NA | Serum | 2669.09 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3361 | NA | NA | Serum | 2878.89 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3362 | NA | NA | Serum | 3208.49 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3363 | NA | NA | Serum | 3934.92 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3364 | NA | NA | Serum | 4153.16 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3365 | NA | NA | Serum | 5264.02 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3366 | NA | NA | Serum | 6387.9 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3367 | NA | NA | Serum | 6529.26 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3368 | NA | NA | Serum | 6937.21 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3369 | NA | NA | Serum | 2953.31 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3370 | NA | NA | Serum | 1450.55 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3371 | NA | NA | Serum | 1779.31 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3372 | NA | NA | Serum | 7007.25 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3373 | NA | NA | Serum | 4194.12 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3374 | NA | NA | Serum | 7651.87 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3375 | NA | NA | Serum | 8562.86 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3376 | NA | NA | Serum | 1082.44 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3377 | NA | NA | Serum | 2769.86 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3378 | NA | NA | Serum | 5753.12 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3379 | NA | NA | Serum | 4281.54 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3380 | NA | NA | Serum | 1207.13 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3381 | NA | NA | Serum | 4169.93 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3382 | NA | NA | Serum | 8762.73 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3383 | NA | NA | Serum | 1563.43 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3384 | NA | NA | Serum | 1331.12 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3385 | NA | NA | Serum | 2545.83 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3386 | NA | NA | Serum | 1866.42 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3387 | NA | NA | Serum | 8812.29 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3388 | NA | NA | Serum | 1945.53 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3389 | NA | NA | Serum | 2281.08 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3390 | NA | NA | Serum | 1563.11 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3391 | NA | NA | Serum | 2281.08 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3392 | NA | NA | Serum | 2682.65 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3393 | NA | NA | Serum | 2900.91 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3394 | NA | NA | Serum | 3279.09 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3395 | NA | NA | Serum | 4054.17 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3396 | NA | NA | Serum | 5247.81 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3397 | NA | NA | Serum | 5336.3 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Upregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3398 | NA | NA | Serum | 6431.4 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3399 | NA | NA | Serum | 6629.53 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3400 | NA | NA | Serum | 8686.87 | MALDI-TOF | Non-small cell lung cancer (NSCLC) | Downregulated in cancer vs normal | 22628229 |
| CancerPDF_ID3413 | AGPPGEAGKPGEQGPGDL | Collagen type a1 | Urine | NA | LC-MS | CRLM( Colorectal liver metastses) | NA | 27186406 |
| CancerPDF_ID3414 | AGPPGEAGKK PGEQGVPGDL | Collagen type a1 | Urine | NA | LC-MS | CRLM( Colorectal liver metastses) | Upregulated in cancer vs normal | 27186406 |
| CancerPDF_ID3415 | KGNSGEPGAPGSKGDTGAKGEPGPVG | Collagen type a1 | Urine | NA | LC-MS | CRLM( Colorectal liver metastses) | NA | 27186406 |
| CancerPDF_ID3543 | PTALGVRGASRS | Bromodomain-containing protein 1 | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3545 | LSALEEYTKK | Apolipoprotein A-I | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3564 | VHLTPEEKSAVT | Hemoglobin subunit beta | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3577 | ALEEYTKKLNTQ | Apolipoprotein A-I | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3584 | DSDDDEPPPLPRL | "Membrane-associated progesterone receptor component 1, PGRMC1" | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3594 | ADSGEGDFLAEGGGVR | Fibrinogen alpha chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3609 | GPpGPPGPPGPPGVSGGGY | Collagen alpha-2(I) chain | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3664 | DEPPQSPWDRVKDLAT | Apolipoprotein A-I | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3791 | VLSPADKTNVKAAWGKVGAHAGEYGAEALER | Hemoglobin subunit alpha | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID8656 | NA | NA | Serum | 5247.62 | MALDI-TOF | "Hepatocellular carcinoma, Liver cirrhosis, Chronic hepatitis" | significantly different from that of normal | 23915185 |
| CancerPDF_ID8657 | NA | NA | Serum | 7637.05 | MALDI-TOF | "Hepatocellular carcinoma, Liver cirrhosis, Chronic hepatitis" | significantly different from that of normal | 23915185 |
| CancerPDF_ID8658 | NA | NA | Serum | 1450.87 | MALDI-TOF | "Hepatocellular carcinoma, Liver cirrhosis, Chronic hepatitis" | significantly different from that of normal | 23915185 |
| CancerPDF_ID8659 | NA | NA | Serum | 4054.21 | MALDI-TOF | "Hepatocellular carcinoma, Liver cirrhosis, Chronic hepatitis" | significantly different from that of normal | 23915185 |
| CancerPDF_ID8660 | NA | NA | Serum | 1073.21 | MALDI-TOF | "Hepatocellular carcinoma, Liver cirrhosis, Chronic hepatitis" | significantly different from that of normal | 23915185 |
| CancerPDF_ID8661 | NA | NA | Serum | 3883.64 | MALDI-TOF | "Hepatocellular carcinoma, Liver cirrhosis, Chronic hepatitis" | significantly different from that of normal | 23915185 |
| CancerPDF_ID8662 | NA | NA | Serum | 5064.37 | MALDI-TOF | "Hepatocellular carcinoma, Liver cirrhosis, Chronic hepatitis" | significantly different from that of normal | 23915185 |
| CancerPDF_ID8663 | NA | NA | Serum | 4644.96 | MALDI-TOF | "Hepatocellular carcinoma, Liver cirrhosis, Chronic hepatitis" | significantly different from that of normal | 23915185 |
| CancerPDF_ID8664 | NA | NA | Serum | 5805.51 | MALDI-TOF | "Hepatocellular carcinoma, Liver cirrhosis, Chronic hepatitis" | significantly different from that of normal | 23915185 |
| CancerPDF_ID8665 | NA | NA | Serum | 1866.47 | MALDI-TOF | "Hepatocellular carcinoma, Liver cirrhosis, Chronic hepatitis" | significantly different from that of normal | 23915185 |
| CancerPDF_ID8666 | NA | NA | Serum | 6579.6 | MALDI-TOF | "Hepatocellular carcinoma, Liver cirrhosis, Chronic hepatitis" | significantly different from that of normal | 23915185 |
| CancerPDF_ID11033 | KEDIDTSSKGGCVQ | RNA-binding protein 6 | Serum | 1466.98 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11034 | AILVDLEPGTMDSVR | tubulin beta chain | Serum | 1618.22 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11035 | IHTGENPYECSECGKAFRYSSALVRHQRIHTGEKPLNGIGMSKSSLRVTTELN | zinc finger protein 3 | Serum | 5905.23 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11036 | NA | NA | Serum | 1866.63 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11037 | NA | NA | Serum | 3317 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11038 | NA | NA | Serum | 6433.36 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11039 | NA | NA | Serum | 1780.1 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11040 | NA | NA | Serum | 1061.34 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11041 | NA | NA | Serum | 5752.25 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11042 | NA | NA | Serum | 5724.76 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11043 | NA | NA | Serum | 5844.36 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11044 | NA | NA | Serum | 5739.69 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11045 | NA | NA | Serum | 5818.83 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11046 | NA | NA | Serum | 4091.86 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11047 | NA | NA | Serum | 1714.57 | MALDI-TOF | Clear cell renal carcinoma | "Upregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11048 | NA | NA | Serum | 1981.69 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11049 | NA | NA | Serum | 1077.14 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11050 | NA | NA | Serum | 1547 | MALDI-TOF | Clear cell renal carcinoma | "Downregulated in ccRCC, preoperative and post operative patients vs control" | 25368985 |
| CancerPDF_ID11122 | NA | NA | Urine | 1894.3 | MALDI-TOF | Clear cell renal carcinoma | Downregulated in ccRCC vs normal according to primary tumor Stage | 26482227 |
| CancerPDF_ID12694 | HTFMGVVSLGSPSGEVSHPRKT | Alpha-2-HS-glycoprotein | Serum | 2326.204 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.58 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.25, Upregulated in BC vs healthy with 1.217 fold change" | 27058005 |
| CancerPDF_ID12700 | HRIHWESASLL | Complement C3 | Serum | 1348.755 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.59 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.13, Upregulated in BC vs healthy with 1.042 fold change" | 27058005 |
| CancerPDF_ID12701 | THRIHWESASLL | Complement C3 | Serum | 1449.804 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.52 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.25, Upregulated in BC vs healthy with 1.134 fold change" | 27058005 |
| CancerPDF_ID12705 | KITHRIHWESASLL | Complement C3 | Serum | 1690.987 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 2.19 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.36, Upregulated in BC vs healthy with 1.341 fold change" | 27058005 |
| CancerPDF_ID12706 | SKITHRIHWESASLL | Complement C3 | Serum | 1778.018 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 2.10 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.37, Upregulated in BC vs healthy with 1.343 fold change" | 27058005 |
| CancerPDF_ID12708 | SSKITHRIHWESASLL | Complement C3 | Serum | 1865.05 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 2.06 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.35, Upregulated in BC vs healthy with 1.344 fold change" | 27058005 |
| CancerPDF_ID12711 | NGFKSHALQLNNRQ | Complement C4 | Serum | 1626.912 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.56 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.80, Upregulated in BC vs healthy with 0.754 fold change" | 27058005 |
| CancerPDF_ID12713 | GFKSHALQLNNRQIR | Complement C4 | Serum | 1782.012 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 1.73 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.16, Upregulated in BC vs healthy with 1.092 fold change" | 27058005 |
| CancerPDF_ID12714 | NGFKSHALQLNNRQIR | Complement C4 | Serum | 1896.068 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.45 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.00, Upregulated in BC vs healthy with 0.968 fold change" | 27058005 |
| CancerPDF_ID12717 | HFFFPKSRIV | Clusterin | Serum | 1277.758 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.39 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.17, Upregulated in BC vs healthy with 1.117 fold change" | 27058005 |
| CancerPDF_ID12719 | AVPPNNSNAAEDDLPTVELQGVVPR | Coagulation factor XIII A chain | Serum | 2602.306 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.47 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.04, Upregulated in BC vs healthy with 1.073 fold change" | 27058005 |
| CancerPDF_ID12723 | SSSYSKQFTSSTSYNRGDSTFES | Fibrinogen alpha chain | Serum | 2553.201 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.60 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.85, Upregulated in BC vs healthy with 0.992 fold change" | 27058005 |
| CancerPDF_ID12736 | GVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 2627.365 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.51 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.86, Upregulated in BC vs healthy with 0.931 fold change" | 27058005 |
| CancerPDF_ID12737 | PGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 2724.46 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.22 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.72, Upregulated in BC vs healthy with 1.080 fold change" | 27058005 |
| CancerPDF_ID12748 | HGLGHGHEQQHGLGHGHKF | Kininogen-1 | Serum | 2070.011 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.25 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.62, Upregulated in BC vs healthy with 1.201 fold change" | 27058005 |
| CancerPDF_ID12750 | GHGLGHGHEQQHGLGHGHKF | Kininogen-1 | Serum | 2127.055 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.10 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.48, Upregulated in BC vs healthy with 1.279 fold change" | 27058005 |
| CancerPDF_ID12751 | KHNLGHGHKHERDQGHGHQ | Kininogen-1 | Serum | 2209.11 | MALDI-TOF | Breast cancer | "Upregulated with the fold change of 0.31 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 1.29, Upregulated in BC vs healthy with 1.499 fold change" | 27058005 |
| CancerPDF_ID12788 | NA | NA | Serum | 4215.59 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12789 | NA | NA | Serum | 5917.99 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12794 | NA | NA | Serum | 1618.25 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12799 | NA | NA | Serum | 1467.15 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12800 | NA | NA | Serum | 1546.94 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12802 | NA | NA | Serum | 9326.19 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12804 | NA | NA | Serum | 4649.53 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12805 | NA | NA | Serum | 7788.6 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12807 | NA | NA | Serum | 1866.77 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12809 | NA | NA | Serum | 5343.62 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12811 | NA | NA | Serum | 3263.33 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12812 | NA | NA | Serum | 3265.04 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12816 | NA | NA | Serum | 1450.79 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12821 | NA | NA | Serum | 3885.75 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12822 | NA | NA | Serum | 1520.78 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12823 | NA | NA | Serum | 7769.65 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12824 | NA | NA | Serum | 3193.79 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID12829 | NA | NA | Serum | 4272.96 | MALDI-TOF | Colorectal adenoma and Colorectal carcinoma | "Differential Peptide Peaks in Colorectal Cancer, Colorectal Adenoma and Health Volunteer Group" | 24289627 |
| CancerPDF_ID14299 | NA | NA | Serum | 3316.09 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14300 | NA | NA | Serum | 6629.59 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14301 | NA | NA | Serum | 3217.15 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14302 | NA | NA | Serum | 3951.98 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14303 | NA | NA | Serum | 6431.45 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14304 | NA | NA | Serum | 4193.85 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14305 | NA | NA | Serum | 6528.84 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14306 | NA | NA | Serum | 6486.39 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14307 | NA | NA | Serum | 4209.86 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14308 | NA | NA | Serum | 4266.53 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14309 | NA | NA | Serum | 3934.72 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14310 | NA | NA | Serum | 4053.89 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14311 | NA | NA | Serum | 4122.53 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14312 | NA | NA | Serum | 3308.63 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14313 | NA | NA | Serum | 4248.53 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14314 | NA | NA | Serum | 4169.65 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14315 | NA | NA | Serum | 9285.78 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14316 | NA | NA | Serum | 6389.31 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14317 | NA | NA | Serum | 4017 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14318 | NA | NA | Serum | 1331.04 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14319 | NA | NA | Serum | 4566.66 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14320 | NA | NA | Serum | 3506.97 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14321 | NA | NA | Serum | 2210.96 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14322 | NA | NA | Serum | 4153.15 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14323 | NA | NA | Serum | 3192.1 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14324 | NA | NA | Serum | 2660.69 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14325 | NA | NA | Serum | 7822.5 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14326 | NA | NA | Serum | 3918.04 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14327 | NA | NA | Serum | 4395.89 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14328 | NA | NA | Serum | 8763.11 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14329 | NA | NA | Serum | 6088.21 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14330 | NA | NA | Serum | 5263.98 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14331 | NA | NA | Serum | 1969.15 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14332 | NA | NA | Serum | 1011.35 | Magnetic bead based weak cation exchange chromatography(MB-WCX) | Gastric cancer | NA | 21739109 |
| CancerPDF_ID14357 | NA | NA | Serum | 5247.62 | MB-WCX | Hepatocellular carcinoma | NA | 23915185 |
| CancerPDF_ID14358 | NA | NA | Serum | 7637.05 | MB-WCX | Hepatocellular carcinoma | NA | 23915185 |
| CancerPDF_ID14359 | NA | NA | Serum | 1450.87 | MB-WCX | Hepatocellular carcinoma | NA | 23915185 |
| CancerPDF_ID14360 | NA | NA | Serum | 4054.21 | MB-WCX | Hepatocellular carcinoma | NA | 23915185 |
| CancerPDF_ID14361 | NA | NA | Serum | 1073.37 | MB-WCX | Hepatocellular carcinoma | NA | 23915185 |
| CancerPDF_ID14362 | NA | NA | Serum | 3883.64 | MB-WCX | Hepatocellular carcinoma | NA | 23915185 |
| CancerPDF_ID14363 | NA | NA | Serum | 5064.37 | MB-WCX | Hepatocellular carcinoma | NA | 23915185 |
| CancerPDF_ID14364 | NA | NA | Serum | 4644.96 | MB-WCX | Hepatocellular carcinoma | NA | 23915185 |
| CancerPDF_ID14365 | NA | NA | Serum | 5805.51 | MB-WCX | Hepatocellular carcinoma | NA | 23915185 |
| CancerPDF_ID14366 | NA | NA | Serum | 1866.47 | MB-WCX | Hepatocellular carcinoma | NA | 23915185 |
| CancerPDF_ID14367 | NA | NA | Serum | 6579.6 | MB-WCX | Hepatocellular carcinoma | NA | 23915185 |