Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
---|---|---|---|---|---|---|---|---|
CancerPDF_ID4764 | ELGPGIMGAIFDGIQRPLSDISSQTQSIYIPRGVNV | V-type proton ATPase catalytic subunit A | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID13846 | YYDKHFTEF | V-type proton ATPase catalytic subunit A | Plasma | 1249.553 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |