Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID1729 | SASDLTWDNLK | Serotransferrin | Serum | 1248.59863 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1730 | SASDLTWDNLKGK | Serotransferrin | Serum | 1433.71506 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1731 | TAGWNIPMGLLYNKIN | Serotransferrin | Serum | 1803.93418 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1732 | ASDLTWDNLK | Serotransferrin | Serum | 1161.5666 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1733 | SASDLTWDNLKGKK | Serotransferrin | Serum | 1561.81002 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1734 | SDLTWDNLKGK | Serotransferrin | Serum | 1275.64592 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1735 | EGYYGYTGAFR | Serotransferrin | Serum | 1282.56185 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1736 | SASDLTWDNLKG | Serotransferrin | Serum | 1305.62009 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1737 | HQTVPQNTGGKNPDPWA | Serotransferrin | Serum | 1845.87581 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1738 | HQTVPQNTGGKNPDPWAK | Serotransferrin | Serum | 1973.97077 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1739 | TAGWNIPMGLLYNK | Serotransferrin | Serum | 1592.8021 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1740 | LHDRNTYEKYLGEEYVK | Serotransferrin | Serum | 2156.05383 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1741 | KSASDLTWDNLK | Serotransferrin | Serum | 1376.69359 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1742 | TAGWNIPMGLLYNK | Serotransferrin | Serum | 1576.80718 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1743 | SDLTWDNLKG | Serotransferrin | Serum | 1147.55095 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1744 | SDLTWDNLK | Serotransferrin | Serum | 1090.52949 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1745 | SASDLTWDNL | Serotransferrin | Serum | 1120.50367 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1746 | ASDLTWDNLKG | Serotransferrin | Serum | 1218.58807 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1747 | TAGWNIPMGLLYN | Serotransferrin | Serum | 1448.71222 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID4290 | ANFFSGSCAPCADGTDFPQLC | Serotransferrin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5340 | GWNIPMGLLYNKI | Serotransferrin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5601 | KHQTVPQNTGGKNPD | Serotransferrin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5614 | KMYLGYEYV | Serotransferrin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5615 | KMYLGYEYVT | Serotransferrin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5693 | LAPNNLKPVVAEF | Serotransferrin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5717 | LDCIRAIAANEADAV | Serotransferrin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6270 | NFFSGSCAPCADGTDFPQLC | Serotransferrin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6544 | QLCPGCGCSTLNQYFGYSGAFKCLKDGAGDV | Serotransferrin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7318 | SYLDCIRAIAANEADAV | Serotransferrin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7458 | TLDAGLVYDAYLAPNNLKPVVAEF | Serotransferrin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7699 | VAEFYGSKED | Serotransferrin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7700 | VAEFYGSKEDPQTF | Serotransferrin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7701 | VAEFYGSKEDPQTFYY | Serotransferrin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7702 | VAEFYGSKEDPQTFYYA | Serotransferrin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7703 | VAEFYGSKEDPQTFYYAV | Serotransferrin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7704 | VAEFYGSKEDPQTFYYAVAV | Serotransferrin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8295 | YLAPNNLKPVVAEF | Serotransferrin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID9028 | LGYEYVTAIR | Serotransferrin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9043 | LLYCDLPEPR | Serotransferrin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9980 | FSSPHGKDLL | Serotransferrin precursor | Urine | 1100.5738 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10018 | YGSKEDPQTF | Serotransferrin precursor | Urine | 1171.5517 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10023 | VKHSTIFENL | Serotransferrin precursor | Urine | 1187.6475 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10078 | ANKADRDQYEL | Serotransferrin precursor | Urine | 1322.6291 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10082 | YGSKEDPQTFY | Serotransferrin precursor | Urine | 1334.5267 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10083 | FVKHSTIFENL | Serotransferrin precursor | Urine | 1334.7147 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10158 | FQLFSSPHGKDLL | Serotransferrin precursor | Urine | 1488.7807 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10204 | YGSKEDPQTFYYA | Serotransferrin precursor | Urine | 1568.7245 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10209 | YLAPNNLKPVVAEF | Serotransferrin precursor | Urine | 1574.8553 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10244 | NQAQEHFGKDKSKE | Serotransferrin precursor | Urine | 1645.7843 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10246 | AYLAPNNLKPVVAEF | Serotransferrin precursor | Urine | 1645.8908 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10280 | FKDSAHGFLKVPPRM | Serotransferrin precursor | Urine | 1729.907 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10300 | LNQAQEHFGKDKSKE | Serotransferrin precursor | Urine | 1758.8699 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10317 | AQEHFGKDKSKEFQL | Serotransferrin precursor | Urine | 1791.9021 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10399 | AKLHDRNTYEKYLGEE | Serotransferrin precursor | Urine | 1965.9475 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10429 | VYDAYLAPNNLKPVVAEF | Serotransferrin precursor | Urine | 2023.0442 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10433 | NQAQEHFGKDKSKEFQL | Serotransferrin precursor | Urine | 2034.0034 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10481 | LNQAQEHFGKDKSKEFQL | Serotransferrin precursor | Urine | 2147.0855 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10561 | DAGLVYDAYLAPNNLKPVVAEF | Serotransferrin precursor | Urine | 2379.2047 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10626 | IWELLNQAQEHFGKDKSKEFQL | Serotransferrin precursor | Urine | 2688.382 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10648 | FKDSAHGFLKVPPRMDAKMYLGYE | Serotransferrin precursor | Urine | 2800.401 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10660 | YLAPNNLKPVVAEFYGSKEDPQTFY | Serotransferrin precursor | Urine | 2890.4384 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10665 | VKHQTVPQNTGGKNPDPWAKNLNEKD | Serotransferrin precursor | Urine | 2915.4496 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10679 | FVKHQTVPQNTGGKNPDPWAKNLNEKD | Serotransferrin precursor | Urine | 3062.5133 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10745 | VKHSTIF | Serotransferrin precursor | Urine | 831.4815 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |