Browse result page of CancerPDF Database

Please click on CancerPDF_ID for detailed information about peptide.

CancerPDF_ID	Peptide seq	Protein Name	Fluid	Mass/Z	Profiling Technique	Cancer Type	Expression Regulation	PUBMED ID
CancerPDF_ID3825	GQGSSEDDLQEEEQIEQAIKEHLNQGSSQETDKLAPVS	Secretogranin-2	Urine	NA	"CE-MS, Micro-TOF-MS"	Bladder cancer	Differentially expressed between recurrence of UBC vs recurrence control	27026199
CancerPDF_ID5540	IVEEQYTPQSLATLESVFQELGKLTGPNNQ	Secretogranin-2	Urine	NA	Nano-LC-MS	Ovarian cancer	Uniquely present in case of urine of ovarian cancer patients	24982608
CancerPDF_ID7552	TNEIVEEQYTPQSLATLESVFQELGKLTGPNNQ	Secretogranin-2	Urine	NA	Nano-LC-MS	Ovarian cancer	Uniquely present in case of urine of ovarian cancer patients	24982608