Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID4059 | AALGCLVKDYFPEPV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4247 | ALGCLVKDYFPEPV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4524 | CLVKDYFPEPV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4538 | CVVVDVSHEDPEVKF | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5101 | GCLVKDYFPEPV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5143 | GGTAALGCLVKDYFPEPV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5308 | GTAALGCLVKDYFPEPV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5309 | GTAALGCLVKDYFPEPV | Putative uncharacterized protein DKFZp686P15220 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5394 | HTFPAVLQSSGLYSLSSVV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5532 | ISRTPEVTCVVVDVSHEDPEVKF | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5591 | KFNWYVDGVEV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5599 | KGPSVFPLAPSSKSTSGGTAALGCLV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5813 | LGCLVKDYFPEPV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5957 | LMISRTPEVTCV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5963 | LMISRTPEVTCVV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5969 | LMISRTPEVTCVVV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6355 | NWFDPWGQGTLV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6364 | NWYVDGVEV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6370 | NWYVDGVEVH | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6376 | NWYVDGVEVHNA | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6843 | SGGTAALGCLVKDYFPEPV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6847 | SGGTAALGCLVKDYFPEPVTV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6892 | SGVHTFPAVLQSSGLYS | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6898 | SGVHTFPAVLQSSGLYSL | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6904 | SGVHTFPAVLQSSGLYSLS | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6910 | SGVHTFPAVLQSSGLYSLSS | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6916 | SGVHTFPAVLQSSGLYSLSSVV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7076 | SRTPEVTCVVVDVSHEDPEVKF | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7084 | SSASTKGPSVFPLAPSSKST | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7144 | STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7154 | STSGGTAALGCLVKDYFPEPV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7202 | SVVTVPSSSLGTQTYICNV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7222 | SWNSGALTSGVHTFPA | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7229 | SWNSGALTSGVHTFPAVL | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7235 | SWNSGALTSGVHTFPAVLQ | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7241 | SWNSGALTSGVHTFPAVLQS | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7247 | SWNSGALTSGVHTFPAVLQSS | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7254 | SWNSGALTSGVHTFPAVLQSSGLY | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7260 | SWNSGALTSGVHTFPAVLQSSGLYS | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7266 | SWNSGALTSGVHTFPAVLQSSGLYSL | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7272 | SWNSGALTSGVHTFPAVLQSSGLYSLS | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7278 | SWNSGALTSGVHTFPAVLQSSGLYSLSS | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7284 | SWNSGALTSGVHTFPAVLQSSGLYSLSSV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7290 | SWNSGALTSGVHTFPAVLQSSGLYSLSSVV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7589 | TVLHQDWLNGKEY | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7596 | TVPSSSLGTQTYI | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7601 | TVPSSSLGTQTYICNV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7611 | TVSWNSGALTSGV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7617 | TVSWNSGALTSGVHTFPA | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7624 | TVSWNSGALTSGVHTFPAVL | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7630 | TVSWNSGALTSGVHTFPAVLQ | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7636 | TVSWNSGALTSGVHTFPAVLQS | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7643 | TVSWNSGALTSGVHTFPAVLQSSGLY | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7649 | TVSWNSGALTSGVHTFPAVLQSSGLYS | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7655 | TVSWNSGALTSGVHTFPAVLQSSGLYSL | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7661 | TVSWNSGALTSGVHTFPAVLQSSGLYSLSS | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7667 | TVSWNSGALTSGVHTFPAVLQSSGLYSLSSV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7673 | TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7773 | VDVSHEDPEVKF | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7919 | VLQSSGLYSL | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7925 | VLQSSGLYSLSS | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7931 | VLQSSGLYSLSSV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7937 | VLQSSGLYSLSSVV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7942 | VLQSSGLYSLSSVVTV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7947 | VLQSSGLYSLSSVVTVPSSSLGTQTYICNV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8015 | VSWNSGALTSGVHTFPA | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8033 | VTVPSSSLGTQTYI | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8038 | VTVPSSSLGTQTYICNV | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8067 | VVDVSHEDPEVKF | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8166 | WNSGALTSGVHTFPA | Putative uncharacterized protein DKFZp686O01196 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |