Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID4057 | AALGCLVKDYFPEPV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4245 | ALGCLVKDYFPEPV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4522 | CLVKDYFPEPV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4537 | CVVVDVSHEDPEVKF | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5099 | GCLVKDYFPEPV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5142 | GGTAALGCLVKDYFPEPV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5307 | GTAALGCLVKDYFPEPV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5392 | HTFPAVLQSSGLYSLSSVV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5531 | ISRTPEVTCVVVDVSHEDPEVKF | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5590 | KFNWYVDGVEV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5598 | KGPSVFPLAPSSKSTSGGTAALGCLV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5811 | LGCLVKDYFPEPV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5955 | LMISRTPEVTCV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5961 | LMISRTPEVTCVV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5967 | LMISRTPEVTCVVV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6362 | NWYVDGVEV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6368 | NWYVDGVEVH | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6374 | NWYVDGVEVHNA | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6738 | SAASTKGPSVFPLAPSSKSTSGGTAALGCLV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6842 | SGGTAALGCLVKDYFPEPV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6846 | SGGTAALGCLVKDYFPEPVTV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6890 | SGVHTFPAVLQSSGLYS | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6896 | SGVHTFPAVLQSSGLYSL | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6902 | SGVHTFPAVLQSSGLYSLS | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6908 | SGVHTFPAVLQSSGLYSLSS | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6914 | SGVHTFPAVLQSSGLYSLSSVV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7075 | SRTPEVTCVVVDVSHEDPEVKF | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7143 | STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7153 | STSGGTAALGCLVKDYFPEPV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7201 | SVVTVPSSSLGTQTYICNV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7220 | SWNSGALTSGVHTFPA | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7227 | SWNSGALTSGVHTFPAVL | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7233 | SWNSGALTSGVHTFPAVLQ | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7239 | SWNSGALTSGVHTFPAVLQS | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7245 | SWNSGALTSGVHTFPAVLQSS | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7252 | SWNSGALTSGVHTFPAVLQSSGLY | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7258 | SWNSGALTSGVHTFPAVLQSSGLYS | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7264 | SWNSGALTSGVHTFPAVLQSSGLYSL | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7270 | SWNSGALTSGVHTFPAVLQSSGLYSLS | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7276 | SWNSGALTSGVHTFPAVLQSSGLYSLSS | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7282 | SWNSGALTSGVHTFPAVLQSSGLYSLSSV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7288 | SWNSGALTSGVHTFPAVLQSSGLYSLSSVV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7588 | TVLHQDWLNGKEY | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7595 | TVPSSSLGTQTYI | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7600 | TVPSSSLGTQTYICNV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7609 | TVSWNSGALTSGV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7615 | TVSWNSGALTSGVHTFPA | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7622 | TVSWNSGALTSGVHTFPAVL | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7628 | TVSWNSGALTSGVHTFPAVLQ | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7634 | TVSWNSGALTSGVHTFPAVLQS | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7641 | TVSWNSGALTSGVHTFPAVLQSSGLY | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7647 | TVSWNSGALTSGVHTFPAVLQSSGLYS | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7653 | TVSWNSGALTSGVHTFPAVLQSSGLYSL | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7659 | TVSWNSGALTSGVHTFPAVLQSSGLYSLSS | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7665 | TVSWNSGALTSGVHTFPAVLQSSGLYSLSSV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7671 | TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7772 | VDVSHEDPEVKF | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7917 | VLQSSGLYSL | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7923 | VLQSSGLYSLSS | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7929 | VLQSSGLYSLSSV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7935 | VLQSSGLYSLSSVV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7940 | VLQSSGLYSLSSVVTV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7946 | VLQSSGLYSLSSVVTVPSSSLGTQTYICNV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8013 | VSWNSGALTSGVHTFPA | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8032 | VTVPSSSLGTQTYI | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8037 | VTVPSSSLGTQTYICNV | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8066 | VVDVSHEDPEVKF | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8164 | WNSGALTSGVHTFPA | Putative uncharacterized protein DKFZp686G11190 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |