Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID3549 | GTCSGCNCNGHAS | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID4228 | AKGSVYIGGAPDVATLTGGRF | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4548 | DAPGQYGAYF | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4549 | DAPGQYGAYFHDDGF | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4550 | DAPGQYGAYFHDDGFLAFPGHV | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4551 | DAPGQYGAYFHDDGFLAFPGHVF | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4552 | DAPGQYGAYFHDDGFLAFPGHVFS | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4553 | DAPGQYGAYFHDDGFLAFPGHVFSRSLPEVPET | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4668 | DPINDGEWHRV | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4871 | FHDDGFLAFPGHV | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4872 | FHDDGFLAFPGHVF | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5024 | FRYQLGSGEARLV | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5216 | GLQDGHLVFRYQLGSGEARLV | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5353 | HDDGFLAFPGHV | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5354 | HDDGFLAFPGHVF | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5355 | HDDGFLAFPGHVFS | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5462 | IGGAPDVATLTGGRFSSGITGCVK | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5463 | IGGAPDVATLTGGRFSSGITGCVKNL | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5679 | LAFPGHVFSRSLPEVPETI | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5680 | LAFPGHVFSRSLPEVPETIEL | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5940 | LLWQGVEVGEAGQGKDF | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5941 | LLWQGVEVGEAGQGKDFI | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5942 | LLWQGVEVGEAGQGKDFISL | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6033 | LRLYQASPADSGEYVCRVLGSSVPLEASVL | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6144 | LWQGVEVGEAGQGKDFI | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6315 | NLVLHSARPGAPPPQPL | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6785 | SEDPINDGEWHRV | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6860 | SGLLLWQGVEVGEAGQGKDFI | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6880 | SGRSPGPNVAVNAKGSVYIGGAPDVA | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6971 | SLGLQDGHLVF | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6972 | SLGLQDGHLVFRY | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6973 | SLGLQDGHLVFRYQLGSGEA | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6974 | SLGLQDGHLVFRYQLGSGEARLV | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7382 | TGGRFSSGITGCVK | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7518 | TLTGGRFSSGITGCV | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7519 | TLTGGRFSSGITGCVK | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7520 | TLTGGRFSSGITGCVKNLV | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7521 | TLTGGRFSSGITGCVKNLVL | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7996 | VSGRSPGPNVAVNAKGSVY | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8171 | WQGVEVGEAGQGKDF | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8172 | WQGVEVGEAGQGKDFI | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8173 | WQGVEVGEAGQGKDFISLGLQDGHL | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8174 | WQGVEVGEAGQGKDFISLGLQDGHLV | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8284 | YIGGAPDVATLTGGRFSSGITGCVKNLVL | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID10191 | HSARPGAPPPQPLDL | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | 1552.8021 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10253 | DAPGQYGAYFHDDGF | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | 1659.6662 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10330 | LREGRRGSIQVDGEEL | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | 1813.9403 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10332 | VSEDPINDGEWHRVTA | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | 1824.8244 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10355 | VSGRSPGPNVAVNAKGSVY | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | 1858.9618 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10412 | LAFPGHVFSRSLPEVPET | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | 1983.0097 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10514 | LAFPGHVFSRSLPEVPETIE | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | 2225.1512 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10735 | FHDDGF | Basement membrane-specific heparan sulfate proteoglycan core protein | Urine | 737.3013 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11079 | NA | PGBM_HUMAN | Urine | 1825.638 | MALDI-TOF | Clear cell renal carcinoma | "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" | 26482227 |