Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID766 | AEDHFSVIDFNQNIR | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 602.28 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID767 | NVKENIQDNISLF | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 767.39 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID768 | FYNQVSTPLLR | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 669.36 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID1767 | ALYAQARA | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 862.4661 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1768 | ALYAQARAK | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 990.56106 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1769 | YAQARAKGK | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 991.55631 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1770 | AKGKTAGLVR | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 999.61891 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1771 | SIKEKTVGR | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1016.59784 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1772 | SSIKEKTVGR | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1103.62987 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1773 | YAQARAKGKTAGLVR | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1588.91616 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1774 | NDLISATKTQVADAKR | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1729.93226 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1775 | NDLISATKTQVADA | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1445.73619 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1776 | NDLISATKTQVADAK | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1573.83115 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1777 | TWRNDLISATKTQVADA | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1888.96429 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1778 | SSIKEKTVGRALYAQAR | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1877.04829 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1779 | SSIKEKTVGRALYAQARA | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1948.08541 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1780 | NVQFNYPHTSVTDVTQNNFHNYFGGSEIVVAGK | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 3682.74407 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1781 | NDLISATK | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 860.46035 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1782 | YGNQDTSSQLK | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1239.57314 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1783 | FYNQVSTPLLR | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1336.71394 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1784 | IYGNQDTSSQLK | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1352.65721 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1785 | IQPSGGTNINEALLR | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1581.84747 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1786 | YIEKIQPSGGTNINEALLR | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 2115.13242 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1787 | LSNENHGIAQRIYGNQDTSSQL | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 2444.16803 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1788 | YIEKIQPSGGTNINEALL | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1959.03131 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1789 | LSNENHGIAQR | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1237.61635 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1790 | LSNENHGIAQRIYGNQDTSSQLK | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 2572.26299 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1791 | IYGNQDTSSQLKKFYNQVSTPLL | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 2643.35443 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1792 | AEDHFSVIDFNQNIR | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1803.85401 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1793 | RLSNENHGIAQRIYGNQDTSSQL | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 2600.26914 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1794 | AKGKTAGLV | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 843.5178 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1795 | SIKEKTVG | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 860.49673 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1796 | SSIKEKTVG | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 947.52876 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1797 | ALYAQARAKGKTAGLV | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 1616.93622 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2899 | SIKEKTVG | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 860.4967 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2900 | ALYAQARA | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 862.4661 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2901 | MKQTVEAM | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 936.4409 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2902 | DKHADPDFT | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 1044.4512 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2903 | LSNENHGIAQ | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 1081.5152 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2904 | SSIKEKTVGR | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 1103.6299 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2905 | FYNQVSTPLL | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 1180.6128 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2906 | LSNENHGIAQR | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 1237.6164 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2907 | KFYNQVSTPLL | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 1308.7078 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2908 | FYNQVSTPLLR | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 1336.7139 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2909 | IYGNQDTSSQLK | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 1352.6572 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2910 | NDLISATKTQVADA | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 1445.7362 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2911 | IYGNQDTSSQLKK | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 1480.7522 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2912 | NDLISATKTQVADAK | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 1573.8312 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2913 | AEDHFSVIDFNQNI | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 1647.7529 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2914 | NDLISATKTQVADAKR | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 1729.9323 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2915 | TWRNDLISATKTQVADA | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 1888.9643 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2916 | YIEKIQPSGGTNINEALL | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 1959.0313 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2917 | TWRNDLISATKTQVADAK | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 2017.0592 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2918 | LSNENHGIAQRIYGNQDTSSQL | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 2444.168 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2919 | TILDDLRAEDHFSVIDFNQNI | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 2474.2078 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2920 | LSNENHGIAQRIYGNQDTSSQLK | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 2572.263 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2921 | IYGNQDTSSQLKKFYNQVSTPLL | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 2643.3544 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2922 | RLSNENHGIAQRIYGNQDTSSQLK | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 2728.3641 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2923 | SILQMSLDHHIVTPLTSLVIENEAGDER | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 3116.5812 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2924 | QTVEAMKTILDDLRAEDHFSVIDFNQNIR | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 3417.6987 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2925 | MKQTVEAMKTILDDLRAEDHFSVIDFNQNI | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 3520.733 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2926 | MKQTVEAMKTILDDLRAEDHFSVIDFNQNIR | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 3676.8342 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3039 | IADNKQSSF | Inter-alpha-trypsin inhibitor heavy chain H1 | Plasma | 1008.4876 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3040 | AISGENAGLVR | Inter-alpha-trypsin inhibitor heavy chain H1 | Plasma | 1085.5829 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3041 | KAAISGENAGLV | Inter-alpha-trypsin inhibitor heavy chain H1 | Plasma | 1128.6139 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3042 | AAISGENAGLVR | Inter-alpha-trypsin inhibitor heavy chain H1 | Plasma | 1156.62 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3043 | QYYEGSEIVVAGR | Inter-alpha-trypsin inhibitor heavy chain H1 | Plasma | 1469.7151 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3044 | GFSLDEATNLNGGLL | Inter-alpha-trypsin inhibitor heavy chain H1 | Plasma | 1519.7518 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3045 | GFSLDEATNLNGGLLR | Inter-alpha-trypsin inhibitor heavy chain H1 | Plasma | 1675.853 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3046 | GSLVQASEANLQAAQDFV | Inter-alpha-trypsin inhibitor heavy chain H1 | Plasma | 1846.9061 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3047 | MSLDYGFVTPLTSMSIR | Inter-alpha-trypsin inhibitor heavy chain H1 | Plasma | 1916.9376 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3048 | GSLVQASEANLQAAQDFVR | Inter-alpha-trypsin inhibitor heavy chain H1 | Plasma | 2003.0072 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3049 | GMADQDGLKPTIDKPSEDSPPLEMLGPR | Inter-alpha-trypsin inhibitor heavy chain H1 | Plasma | 2993.4474 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3050 | GMADQDGLKPTIDKPSEDSPPLEMLGPRR | Inter-alpha-trypsin inhibitor heavy chain H1 | Plasma | 3149.5485 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID11241 | ALYAQARAK | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | 990.56106 | LC-MS | Melanoma | "Present in 3 cancer samples out of 8 cancer samples. ,Present in 2 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID12204 | SLAPTAAAK | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | NA | LC-MS | Melanoma | "Present in 3 cancer samples out of 8 cancer samples. ,Present in 0 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID12566 | VELAPGKFQL | Inter-alpha-trypsin inhibitor heavy chain H2 | Serum | NA | LC-MS | Melanoma | "Present in 1 cancer samples out of 8 cancer samples. ,Present in 0 healthy samples out of 4 healthy samples." | 26992070 |