Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID2116 | NSVIKVPMMN | Plasma protease C1 inhibitor | Serum | 1131.57804 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2117 | NSVIKVPMMNS | Plasma protease C1 inhibitor | Serum | 1218.61006 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2118 | AIMEKLEMSKFQPTLLTLPR | Plasma protease C1 inhibitor | Serum | 2345.2851 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID4264 | ALNPESNTAGLDIFAKF | Chloride intracellular channel protein 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4766 | ELTETGVEAAAASAI | Plasma protease C1 inhibitor | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4767 | ELTETGVEAAAASAISVAR | Plasma protease C1 inhibitor | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4768 | ELTETGVEAAAASAISVARTL | Plasma protease C1 inhibitor | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4769 | ELTETGVEAAAASAISVARTLL | Plasma protease C1 inhibitor | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5054 | FTTKGVTSVSQIFHSPDL | Plasma protease C1 inhibitor | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5339 | GVTSVSQIFHSPDL | Plasma protease C1 inhibitor | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5484 | IKVTTSQDMLSIMEKL | Plasma protease C1 inhibitor | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5485 | IKVTTSQDMLSIMEKLE | Plasma protease C1 inhibitor | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5628 | KVETNMAFSPFSIASL | Plasma protease C1 inhibitor | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5663 | KVTTSQDMLSIMEKLE | Plasma protease C1 inhibitor | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6083 | LSYPKDFTCV | Plasma protease C1 inhibitor | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6317 | NMAFSPFSIASLLTQV | Plasma protease C1 inhibitor | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6926 | SIASLLTQVLLGAGENT | Plasma protease C1 inhibitor | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7371 | TETGVEAAAASAISVARTL | Plasma protease C1 inhibitor | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7799 | VETNMAFSPFSIASL | Plasma protease C1 inhibitor | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7800 | VETNMAFSPFSIASLLTQ | Plasma protease C1 inhibitor | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8601 | SARLNSQRLVFNRPFLMFIVDNNILFLGKVNRP | Protein c inhibitor | Serum | 3888.15 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8602 | SARLNSQRLVFNRPFLMF | Protein c inhibitor | Serum | 2195.18 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8603 | SARLNSQRLVFNRPFLM | Protein c inhibitor | Serum | 2048.11 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8611 | MGRVYDPRA | C1-inhibitor | Serum | 1063.52 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID9153 | QDPESLQDRGEGKVA | Plasma protease C1 inhibitor | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID11869 | KVATTVISK | Plasma protease C1 inhibitor | Serum | NA | LC-MS | Melanoma | "Present in 3 cancer samples out of 8 cancer samples. ,Present in 3 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID12100 | RRTETVQKL | Chloride intracellular channel protein 1 | Serum | 1129.6568 | LC-MS | Melanoma | "Present in 4 cancer samples out of 8 cancer samples. ,Present in 2 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID13170 | SRLTLLTLL | Plasma protease C1 inhibitor | Plasma | 1029.667 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |
| CancerPDF_ID13454 | AQIQVQHV | Glutamine-rich protein 1 | Plasma | 922.511 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |