Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID104 | YVGKKQL | Haptoglobin precursor | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID105 | VQKTIAEN | Haptoglobin precursor | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID106 | GRNANFKF | Haptoglobin precursor | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID107 | YTLNNEKQ | Haptoglobin precursor | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID108 | YAEVGRVGY | Haptoglobin precursor | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID109 | KFTDHLKY | Haptoglobin precursor | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID110 | YVGKKQLVE | Haptoglobin precursor | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID111 | WVQKTIAEN | Haptoglobin precursor | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID112 | FAVHDLEEDT | Haptoglobin precursor | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID113 | FKFTDHLKY | Haptoglobin precursor | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID114 | AVHDLEEDTW | Haptoglobin precursor | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID115 | YVGKKQLVEIE | Haptoglobin precursor | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID116 | DAKGSFPWQAKM | Haptoglobin precursor | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID117 | ANFKFTDHLKY | Haptoglobin precursor | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID118 | GRNANFKFTDHLKY | Haptoglobin precursor | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID2096 | VGYVSGWGRN | Haptoglobin | Serum | 1093.53049 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2097 | VGYVSGWGR | Haptoglobin | Serum | 979.48756 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2098 | LRTEGDGVYTLNNEKQWIN | Haptoglobin | Serum | 2249.10766 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID4138 | AEYGVYVKVT | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4180 | AGMSKYQEDTCY | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4369 | ATGILSFDKSCAVA | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4370 | ATGILSFDKSCAVAEY | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4371 | ATGILSFDKSCAVAEYGVYV | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4446 | CAGMSKYQEDTCY | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4516 | CLPSKDYAEVGRV | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4517 | CLPSKDYAEVGRVG | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4518 | CLPSKDYAEVGRVGYV | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4519 | CLPSKDYAEVGRVGYVSGWGRNA | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4703 | DWVQKTIAEN | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4794 | FCAGMSKYQEDTCY | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5095 | GATLINEQWLLTTAKNL | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5103 | GDAGSAFAVHDLEEDTWY | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5104 | GDAGSAFAVHDLEEDTWYA | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5105 | GDAGSAFAVHDLEEDTWYAT | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5106 | GDAGSAFAVHDLEEDTWYATGILSFDKSCAV | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5158 | GILSFDKSCAV | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5159 | GILSFDKSCAVA | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5160 | GILSFDKSCAVAEY | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5161 | GILSFDKSCAVAEYGVYV | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5288 | GSFPWQAKM | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5337 | GVQPILNEHTFC | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5338 | GVQPILNEHTFCAGMSKY | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5347 | GYVSGWGRNA | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5348 | GYVSGWGRNANF | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5349 | GYVSGWGRNANFKF | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5357 | HDLEEDTWYA | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5358 | HDLEEDTWYAT | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5359 | HDLEEDTWYATGI | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5488 | ILGGHLDAKGSFPWQA | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5489 | ILGGHLDAKGSFPWQAKMV | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5504 | INEQWLLTTAKN | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5605 | KLKQKVSVNERVMPI | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5661 | KVTSIQDWVQKT | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5662 | KVTSIQDWVQKTI | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5865 | LINEQWLLTTAKNL | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5978 | LNEHTFCAGMSKY | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5979 | LNEHTFCAGMSKYQEDT | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5980 | LNEHTFCAGMSKYQEDTCY | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5981 | LNEHTFCAGMSKYQEDTCYGDAGSAF | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5982 | LNEHTFCAGMSKYQEDTCYGDAGSAFAV | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6063 | LSFDKSCAVAEY | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6064 | LSFDKSCAVAEYGVYV | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6157 | LYVGKKQLVEIEKV | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6197 | MLPVADQDQCI | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6261 | NEQWLLTTAKNL | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6271 | NFKFTDHLKYV | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6439 | PSKDYAEVGRV | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6440 | PSKDYAEVGRVG | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6441 | PSKDYAEVGRVGYV | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6808 | SFDKSCAVAEY | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6809 | SFDKSCAVAEYGVYV | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6810 | SFIPDFAVAIPTFRQLGTVQQV | Isoform 1 of Collagen alpha-3(VI) chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6943 | SIQDWVQKT | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6944 | SIQDWVQKTIAEN | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7379 | TGATLINEQWLLTTAKNL | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7384 | TGILSFDKSCAV | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7385 | TGILSFDKSCAVAEY | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7386 | TGILSFDKSCAVAEYGVYV | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7495 | TLINEQWLLT | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7496 | TLINEQWLLTT | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7497 | TLINEQWLLTTAKNL | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7571 | TSIQDWVQKT | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7572 | TSIQDWVQKTIAEN | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7764 | VDSGNDVTDIADDGCPKPPEIA | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7862 | VKVTSIQDWVQKTIAEN | Haptoglobin isoform 2 preproprotein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8724 | AVGDKLPECEADDGCPKPPEIAH | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8753 | DKLPECEADDGCPKPPE | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8754 | DKLPECEADDGCPKPPEIAH | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8781 | DVTDIADDGCPKPPE | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8824 | FDKSCAVAEY | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8884 | GNDVTDIADDGCPKPPEIAH | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8967 | ILSFDKSCAVAEY | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8973 | INKAVGDKLPECEADDGCPKPPEIAH | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9000 | KLPECEADDGCPKPPE | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9046 | LPECEADDGCPKPPE | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9054 | LPVADQDQCIRHYEG | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9057 | LRTEGDGVYTLNNE | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9072 | MLPVADQDQCIRHYEG | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9074 | MPICLPSKDY | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9079 | MSKYQEDTCYGDAG | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9084 | NDVTDIADDGCPKPPE | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9085 | NDVTDIADDGCPKPPEIAH | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9239 | SKYQEDTCYGDAG | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9240 | SKYQEDTCYGDAGSA | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9289 | TEGDGVYTLNNE | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9290 | TEGDGVYTLNNEK | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9294 | TGILSFDKSC | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9295 | TGILSFDKSCAVAEY | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9355 | VDSGNDVTDIADDGCPKPPE | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9356 | VDSGNDVTDIADDGCPKPPEIAH | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9387 | VMLPVADQDQCIRHYEG | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9388 | VMPICLPSKDY | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9389 | VMPICLPSKDYAE | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9391 | VNERVMPICLPSKDYAE | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9407 | VSVNERVMPICLPSKDYAE | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9442 | YQEDTCYGDAG | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9443 | YQEDTCYGDAGS | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9444 | YQEDTCYGDAGSA | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9446 | YVMLPVADQDQCIRHYEG | Haptoglobin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9448 | NA | Haptoglobin | Serum | NA | Affinity Column and Mass spectrometer | Lung squamous cell carcinoma | Significant higher expression in SSC patient | 26783151 |
| CancerPDF_ID9449 | NA | Haptoglobin | Serum | NA | Affinity Column and Mass spectrometer | Lung squamous cell carcinoma | Significant higher expression in SSC patient | 26783151 |
| CancerPDF_ID9774 | LGGHLDAK | Haptoglobin | Serum | 405.72 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9775 | VDSGNDVTDIADD | Haptoglobin | Serum | 668.28 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9776 | VDSGNDVTDIADDG | Haptoglobin | Serum | 696.79 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9777 | VDSGNDVTDIAD | Haptoglobin | Serum | 610.76 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9778 | SIQDWVQKTIAEN | Haptoglobin | Serum | 766.41 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID10098 | DAKGSFPWQAKM | Haptoglobin | Urine | 1365.6454 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10190 | INEQWLLTTAKNL | Haptoglobin | Urine | 1543.8459 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10333 | ILGGHLDAKGSFPWQAK | Haptoglobin | Urine | 1824.9904 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10396 | ILGGHLDAKGSFPWQAKM | Haptoglobin | Urine | 1956.0108 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID13246 | WVQKTIAEN | Haptoglobin | Plasma | 1088.574 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |
| CancerPDF_ID13459 | TAKDIAPTL | Haptoglobin | Plasma | 929.531 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |