Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID725 | VHLTPEEKSAVTALWGKVNVDEVGGEALGR | Hemoglobin subunit beta | Plasma | 1054.55 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID726 | VHLTPEEKSAVTALWGK | Hemoglobin subunit beta | Plasma | 622.67 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID727 | LTPEEKSAVTALWGKVNVDEVGGEALGR | Hemoglobin subunit beta | Plasma | 975.84 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID728 | SAVTALWGKVNVDEVGGEALGR | Hemoglobin subunit beta | Plasma | 743.39 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID729 | SAVTALWGKVNVDEVGGEALG | Hemoglobin subunit beta | Plasma | 1036.53 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID730 | SAVTALWGK | Hemoglobin subunit beta | Plasma | 466.76 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID731 | TALWGKVNVDEV | Hemoglobin subunit beta | Plasma | 665.85 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID732 | TALWGKVNV | Hemoglobin subunit beta | Plasma | 494.28 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID733 | KVNVDEVGGEALGR | Hemoglobin subunit beta | Plasma | 481.59 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID734 | VNVDEVGGEALGR | Hemoglobin subunit beta | Plasma | 657.83 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID735 | DEVGGEALGRLLV | Hemoglobin subunit beta | Plasma | 664.36 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID736 | DEVGGEALGRLL | Hemoglobin subunit beta | Plasma | 614.83 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID2243 | VVAGVANALAHKYH | Hemoglobin subunit beta | Serum | 1448.78883 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID3429 | VDEVGGEALGRL | Hemoglobin subunit beta | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3436 | VHLTPEEKSAVT | Hemoglobin subunit beta | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3437 | VAGVANALAHKYH | Hemoglobin subunit beta | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3443 | VVAGVANALAHKYH | Hemoglobin subunit beta | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3465 | WGKVNVDEVGGEALGRL | "Hemoglobin subunit beta, HBB" | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3507 | LTPEEKSAVTALWGKVNVDEVGGEALGRL | "Hemoglobin subunit beta, HBB" | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between primary UBC and normal individual | 27026199 |
| CancerPDF_ID3564 | VHLTPEEKSAVT | Hemoglobin subunit beta | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3567 | VAGVANALAHKYH | Hemoglobin subunit beta | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3580 | VVAGVANALAHKYH | Hemoglobin subunit beta | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3586 | DGLAHLDNLKGTFA | Hemoglobin subunit beta | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3613 | FSDGLAHLDNLKGTF | Hemoglobin subunit beta | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID3648 | WGKVNVDEVGGEALGRL | "Hemoglobin subunit beta, HBB" | Urine | NA | "CE-MS, Micro-TOF-MS" | Bladder cancer | Differentially expressed between recurrence of UBC vs recurrence control | 27026199 |
| CancerPDF_ID4281 | ALWGKVNVDEVGGEALGRLLV | Hemoglobin subunit beta | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4565 | DEVGGEALGRLLV | Hemoglobin subunit beta | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4829 | FESFGDLSTPDAV | Hemoglobin subunit beta | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5629 | KVLGAFSDGLAHLDNLKGTFA | Hemoglobin subunit beta | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6340 | NVDEVGGEALGRLLV | Hemoglobin subunit beta | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6778 | SDGLAHLDNLKGTFA | Hemoglobin subunit beta | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7346 | TALWGKVNVDEV | Hemoglobin subunit beta | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7347 | TALWGKVNVDEVGGEALGRLLV | Hemoglobin subunit beta | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8107 | VYPWTQRFFESF | Hemoglobin subunit beta | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8108 | VYPWTQRFFESFGDLSTPDAV | Hemoglobin subunit beta | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8136 | WGKVNVDEVGGEALGRLLV | Hemoglobin subunit beta | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID9773 | ALAHKYH | Hemoglobin subunit beta | Serum | 420.22 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9958 | FRLLGNVLV | Hemoglobin subunit beta | Urine | 1030.638 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID9965 | VVYPWTQR | Hemoglobin subunit beta | Urine | 1048.5583 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10011 | LVVYPWTQR | Hemoglobin subunit beta | Urine | 1161.6392 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10025 | VVYPWTQRF | Hemoglobin subunit beta | Urine | 1195.629 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10033 | LAHLDNLKGTF | Hemoglobin subunit beta | Urine | 1228.6683 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10055 | PENFRLLGNVL | Hemoglobin subunit beta | Urine | 1271.7212 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10070 | LVVYPWTQRF | Hemoglobin subunit beta | Urine | 1308.6826 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10071 | VHLTPEEKSAVT | Hemoglobin subunit beta | Urine | 1310.7355 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10096 | WGKVNVDEVGGEA | Hemoglobin subunit beta | Urine | 1359.605 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10120 | VNVDEVGGEALGRL | Hemoglobin subunit beta | Urine | 1427.7106 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10136 | VVAGVANALAHKYH | Hemoglobin subunit beta | Urine | 1449.7992 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10148 | WGKVNVDEVGGEAL | Hemoglobin subunit beta | Urine | 1472.7381 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10156 | SDGLAHLDNLKGTF | Hemoglobin subunit beta | Urine | 1487.752 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10162 | AHHFGKEFTPPVQ | Hemoglobin subunit beta | Urine | 1494.7507 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10163 | VHLTPEEKSAVTAL | Hemoglobin subunit beta | Urine | 1494.8147 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10201 | AHHFGKEFTPPVQA | Hemoglobin subunit beta | Urine | 1565.714 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10223 | LAHHFGKEFTPPVQ | Hemoglobin subunit beta | Urine | 1607.812 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10227 | GKVNVDEVGGEALGRL | Hemoglobin subunit beta | Urine | 1612.8639 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10230 | HVDPENFRLLGNVL | Hemoglobin subunit beta | Urine | 1622.8663 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10236 | FSDGLAHLDNLKGTF | Hemoglobin subunit beta | Urine | 1634.8167 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10237 | AHHFGKEFTPPVQAA | Hemoglobin subunit beta | Urine | 1636.8197 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10272 | VLAHHFGKEFTPPVQ | Hemoglobin subunit beta | Urine | 1706.8938 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10279 | GKVNVDEVGGEALGRLL | Hemoglobin subunit beta | Urine | 1725.9539 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10294 | LAHHFGKEFTPPVQAA | Hemoglobin subunit beta | Urine | 1749.9175 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10322 | WGKVNVDEVGGEALGRL | Hemoglobin subunit beta | Urine | 1798.948 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10331 | LVVYPWTQRFFESF | Hemoglobin subunit beta | Urine | 1818.9135 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10351 | VLAHHFGKEFTPPVQAA | Hemoglobin subunit beta | Urine | 1848.8949 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10359 | YQKVVAGVANALAHKYH | Hemoglobin subunit beta | Urine | 1869.0127 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10374 | VCVLAHHFGKEFTPPVQ | Hemoglobin subunit beta | Urine | 1908.9705 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10377 | WGKVNVDEVGGEALGRLL | Hemoglobin subunit beta | Urine | 1912.0233 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10380 | ATLSELHCDKLHVDPEN | Hemoglobin subunit beta | Urine | 1920.8422 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10386 | AYQKVVAGVANALAHKYH | Hemoglobin subunit beta | Urine | 1940.0239 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10410 | DKLHVDPENFRLLGNVL | Hemoglobin subunit beta | Urine | 1979.0686 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10413 | ALWGKVNVDEVGGEALGRL | Hemoglobin subunit beta | Urine | 1983.061 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10422 | AAYQKVVAGVANALAHKYH | Hemoglobin subunit beta | Urine | 2011.0843 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10440 | VCVLAHHFGKEFTPPVQAA | Hemoglobin subunit beta | Urine | 2051.0364 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10445 | ATLSELHCDKLHVDPENF | Hemoglobin subunit beta | Urine | 2067.93 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10463 | LVVYPWTQRFFESFGDL | Hemoglobin subunit beta | Urine | 2104.0387 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10522 | AVTALWGKVNVDEVGGEALGRL | Hemoglobin subunit beta | Urine | 2254.2099 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10597 | SELHCDKLHVDPENFRLLGNVL | Hemoglobin subunit beta | Urine | 2548.2929 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10653 | ATLSELHCDKLHVDPENFRLLGNVL | Hemoglobin subunit beta | Urine | 2833.4663 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10667 | TPEEKSAVTALWGKVNVDEVGGEALGRL | Hemoglobin subunit beta | Urine | 2925.5337 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10671 | VHLTPEEKSAVTALWGKVNVDEVGGEAL | Hemoglobin subunit beta | Urine | 2948.5494 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10685 | GTFATLSELHCDKLHVDPENFRLLGNVL | Hemoglobin subunit beta | Urine | 3138.5392 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10697 | VHLTPEEKSAVTALWGKVNVDEVGGEALGRL | Hemoglobin subunit beta | Urine | 3274.7428 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10713 | AHHFGKEFTPPVQAAYQKVVAGVANALAHKYH | Hemoglobin subunit beta | Urine | 3486.8198 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10719 | VLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH | Hemoglobin subunit beta | Urine | 3698.9762 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10723 | STPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTF | Hemoglobin subunit beta | Urine | 3821.0473 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10727 | VCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH | Hemoglobin subunit beta | Urine | 3901.0777 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10731 | GDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTF | Hemoglobin subunit beta | Urine | 4106.2409 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10732 | FESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTF | Hemoglobin subunit beta | Urine | 4616.5053 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10754 | FRLLGNVL | Hemoglobin subunit beta | Urine | 931.5745 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11317 | AVMGNPKVK | Hemoglobin subunit beta | Serum | 942.53207 | LC-MS | Melanoma | "Present in 5 cancer samples out of 8 cancer samples. ,Present in 3 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID11535 | GVANALAHK | Hemoglobin subunit beta | Serum | 879.49265 | LC-MS | Melanoma | "Present in 3 cancer samples out of 8 cancer samples. ,Present in 4 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID12449 | TPEEKSAVTA | Hemoglobin subunit beta | Serum | 1031.5135 | LC-MS | Melanoma | "Present in 3 cancer samples out of 8 cancer samples. ,Present in 0 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID12545 | VANALAHKY | Hemoglobin subunit beta | Serum | 985.53451 | LC-MS | Melanoma | "Present in 2 cancer samples out of 8 cancer samples. ,Present in 1 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID12648 | AVMGNPKVK | Hemoglobin subunit beta | Serum | NA | LC-MS | Melanoma | "Present in 5 cancer samples out of 8 cancer samples. ,Present in 3 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID12649 | DAAYMNKV | "Keratin, type II cytoskeletal 5" | Serum | NA | LC-MS | Melanoma | "Present in 2 cancer samples out of 8 cancer samples. ,Present in 4 healthy samples out of 4 healthy samples." | 26992070 |