Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID1877 | ATASRGASQAGAPQGR | Gelsolin | Serum | 1484.7444 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1878 | ATASRGASQAGAPQG | Gelsolin | Serum | 1328.64329 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1879 | TASRGASQAGAPQGR | Gelsolin | Serum | 1413.70729 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1880 | GASQAGAPQGR | Gelsolin | Serum | 998.48936 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1881 | TASRGASQAGAPQG | Gelsolin | Serum | 1257.60618 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1882 | ATASRGASQAGAPQ | Gelsolin | Serum | 1271.62183 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1883 | TASRGASQAGAPQ | Gelsolin | Serum | 1200.58471 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1884 | SRGASQAGAPQ | Gelsolin | Serum | 1028.49992 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1885 | SRGASQAGAPQG | Gelsolin | Serum | 1085.52138 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1886 | SRGASQAGAPQGR | Gelsolin | Serum | 1241.62249 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID3115 | KGGVASGF | Gelsolin | Plasma | 721.3759 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3116 | DGKIFVW | Gelsolin | Plasma | 863.4541 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3117 | YIETDPANR | Gelsolin | Plasma | 1077.5091 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3118 | AGKEPGLQIW | Gelsolin | Plasma | 1097.5869 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3119 | AALKTASDFIT | Gelsolin | Plasma | 1136.6077 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3120 | ATASRGASQAGAPQG | Gelsolin | Plasma | 1328.6433 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3121 | HVVPNEVVVQRLFQV | Gelsolin | Plasma | 1761.989 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3122 | HVVPNEVVVQRLFQVK | Gelsolin | Plasma | 1890.084 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3123 | VPEARPNSMVVEHPEFL | Gelsolin | Plasma | 1949.9669 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3124 | AQPVQVAEGSEPDGFWEALGGK | Gelsolin | Plasma | 2271.0808 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3125 | MDYPKQTQVSVLPEGGETPLF | Gelsolin | Plasma | 2335.1406 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3126 | NWRDPDQTDGLGLSYLSSHIANVER | Gelsolin | Plasma | 2842.3634 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3127 | TASDFITKMDYPKQTQVSVLPEGGETPLF | Gelsolin | Plasma | 3198.5795 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3128 | AALKTASDFITKMDYPKQTQVSVLPEGGETPLF | Gelsolin | Plasma | 3581.8327 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID4098 | AAYLWVGTGASEAEKTGAQELLRVLRAQPV | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4300 | ANVERVPFDAATLHTSTA | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4531 | CSNKIGRFVIEEVPGELMQEDLATDDVML | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4556 | DDDYWSVDPLDRAM | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4559 | DEELGGTPVQSRVVQGKEPAHL | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4657 | DLVPVPTNLYGDFFTGDAYV | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4725 | EEVPGELMQEDLATDDVML | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4732 | EGSNKVPVDPATYGQFYGGDSYII | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4862 | FGGKPMIIYKGGTSREGGQTAPASTRL | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4955 | FLGWDDDYWSVDPLDR | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4956 | FLGWDDDYWSVDPLDRAM | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4957 | FLGWDDDYWSVDPLDRAMA | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4958 | FLGWDDDYWSVDPLDRAMAE | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4959 | FLGWDDDYWSVDPLDRAMAEL | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5014 | FQVRANSAGATRAVEVLPKAGALNSNDA | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5066 | FVLKTPSAAY | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5067 | FVLKTPSAAYLWVGTGASEAEKTGAQEL | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5077 | FVWVGKDSQEEEKTEAL | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5283 | GRFVIEEVPGELMQEDLATDDVML | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5315 | GTGASEAEKTGAQELLRV | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5384 | HLMSLFGGKPMII | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5416 | IANVERVPFDAA | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5417 | IANVERVPFDAATLHTSTA | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5433 | IEEVPGELMQEDLATDDV | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5434 | IEEVPGELMQEDLATDDVML | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5562 | IYNWQGAQSTQDEV | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5563 | IYNWQGAQSTQDEVA | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5564 | IYNWQGAQSTQDEVAASAI | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5617 | KQGFEPPSFV | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5737 | LDTWDQVFV | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5844 | LGWDDDYWSVDPLDR | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5845 | LGWDDDYWSVDPLDRA | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5846 | LGWDDDYWSVDPLDRAM | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5847 | LGWDDDYWSVDPLDRAMA | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5848 | LGWDDDYWSVDPLDRAMAE | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5849 | LGWDDDYWSVDPLDRAMAEL | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5850 | LGWDDDYWSVDPLDRAMAELAA | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6047 | LRVLRAQPVQVAEGSEPDGF | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6078 | LSSHIANVERVPFDAA | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6079 | LSSHIANVERVPFDAATL | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6080 | LSSHIANVERVPFDAATLHTSTA | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6084 | LTAQLDEELGGTPV | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6085 | LTAQLDEELGGTPVQSRVV | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6145 | LWVGTGASEAEKTGAQ | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6146 | LWVGTGASEAEKTGAQELL | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6147 | LWVGTGASEAEKTGAQELLRV | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6148 | LWVGTGASEAEKTGAQELLRVLRAQPV | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6194 | MLLDTWDQVF | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6252 | NDAFVLKTPSAAYLWV | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6316 | NLYGDFFTGDAYV | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6343 | NVERVPFDAA | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6344 | NVERVPFDAATL | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6345 | NVERVPFDAATLHTSTA | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6591 | QVAEGSEPDGFWEALGGKA | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6592 | QVAEGSEPDGFWEALGGKAAY | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6969 | SLFGGKPMII | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7023 | SNKIGRFVIEEVPGELMQEDLATDDV | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7024 | SNKIGRFVIEEVPGELMQEDLATDDVML | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7093 | SSHIANVERVPFDAATLHTSTA | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7165 | SVLPEGGETPLFKQFF | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7167 | SVMPGLKMTMDKTGLLL | Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7212 | SWESFNNGDCF | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7213 | SWESFNNGDCFI | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7214 | SWESFNNGDCFIL | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7348 | TAQLDEELGGTPVQSRVVQGKEPAHL | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7676 | TVVKQGFEPPSF | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7677 | TVVKQGFEPPSFV | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7683 | TYGQFYGGDSY | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7684 | TYGQFYGGDSYI | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7685 | TYGQFYGGDSYII | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7788 | VERVPFDAA | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7789 | VERVPFDAATL | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7801 | VEVLPKAGALNSNDAF | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7802 | VEVLPKAGALNSNDAFVLKTPSAAYL | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7849 | VGTGASEAEKTGAQEL | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7860 | VKQGFEPPSF | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7905 | VLKTPSAAYLWV | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8087 | VVKQGFEPPSF | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8088 | VVKQGFEPPSFV | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8089 | VVKQGFEPPSFVG | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8120 | WDDDYWSVDPLDR | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8121 | WDDDYWSVDPLDRAM | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8122 | WDDDYWSVDPLDRAMAE | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8179 | WSVDPLDRAM | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8180 | WSVDPLDRAMA | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8181 | WSVDPLDRAMAE | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8182 | WSVDPLDRAMAEL | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8193 | WVGTGASEAEKTGAQE | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8194 | WVGTGASEAEKTGAQELLR | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8195 | WVGTGASEAEKTGAQELLRVLRAQPV | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8316 | YLWVGTGASEAEKT | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8317 | YLWVGTGASEAEKTGAQEL | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8318 | YLWVGTGASEAEKTGAQELL | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8319 | YLWVGTGASEAEKTGAQELLRV | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8320 | YLWVGTGASEAEKTGAQELLRVLRAQPV | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8323 | YNWQGAQSTQDEVA | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8324 | YNWQGAQSTQDEVAAS | Isoform 1 of Gelsolin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID9126 | NWRDPDQTDGLG | Isoform 1 of Gelsolin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9399 | VPFDAATLH | Isoform 1 of Gelsolin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9400 | VPFDAATLHTSTA | Isoform 1 of Gelsolin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9430 | WRDPDQTDGLG | Isoform 1 of Gelsolin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9769 | ATASRGASQAGAPQGRVPEARPN | Gelsolin | Serum | 563.04 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9770 | TASRGASQAGAPQGR | Gelsolin | Serum | 472.23 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9978 | FVLKTPSAAY | Gelsolin | Urine | 1096.6118 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10021 | LRVLRAQPVQ | Gelsolin | Urine | 1179.7158 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10039 | VVKQGFEPPSF | Gelsolin | Urine | 1234.6472 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10091 | FQVRANSAGATRA | Gelsolin | Urine | 1348.7012 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10186 | SSHIANVERVPFDA | Gelsolin | Urine | 1541.7638 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10278 | YNYRHGGRQGQIIY | Gelsolin | Urine | 1724.845 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10493 | LRVLRAQPVQVAEGSEPDGF | Gelsolin | Urine | 2168.1372 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10555 | DEELGGTPVQSRVVQGKEPAHL | Gelsolin | Urine | 2346.2069 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10622 | AQLDEELGGTPVQSRVVQGKEPAHL | Gelsolin | Urine | 2658.381 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10640 | TAQLDEELGGTPVQSRVVQGKEPAHL | Gelsolin | Urine | 2759.4407 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10644 | FGGKPMIIYKGGTSREGGQTAPASTRL | Gelsolin | Urine | 2780.4268 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10651 | FQVRANSAGATRAVEVLPKAGALNSNDA | Gelsolin | Urine | 2827.4844 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID11251 | APHRPAPAL | Gelsolin | Serum | NA | LC-MS | Melanoma | "Present in 1 cancer samples out of 8 cancer samples. ,Present in 1 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID11647 | IIYKGGTSR | Gelsolin | Serum | 993.56073 | LC-MS | Melanoma | "Present in 3 cancer samples out of 8 cancer samples. ,Present in 3 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID12371 | TASRGASQAGAPQ | Gelsolin | Serum | 1200.5847 | LC-MS | Melanoma | "Present in 7 cancer samples out of 8 cancer samples. ,Present in 3 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID12372 | TASRGASQAGAPQGR | Gelsolin | Serum | 1413.7073 | LC-MS | Melanoma | "Present in 5 cancer samples out of 8 cancer samples. ,Present in 2 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID13302 | PLDRAMAELAA | Gelsolin | Plasma | 1157.599 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |
| CancerPDF_ID13812 | ASDFITKMDY | Gelsolin | Plasma | 1190.54 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |