Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID121 | FTSHNGMQ | Fibrinogen gamma chain | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID122 | IQYKEGFGHLSPTGTTE | Fibrinogen gamma chain | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID123 | IQYKEGFGHLSPTGTTEF | Fibrinogen gamma chain | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID2855 | NWIQYK | Fibrinogen gamma | Plasma | 850.4337 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2856 | VGPEADKY | Fibrinogen gamma | Plasma | 877.4182 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2857 | LDGSVDFK | Fibrinogen gamma | Plasma | 879.4338 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2858 | TSEVKQLI | Fibrinogen gamma | Plasma | 916.523 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2859 | KNWIQYK | Fibrinogen gamma | Plasma | 978.5287 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2860 | ELEDWNGR | Fibrinogen gamma | Plasma | 1017.4516 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2861 | VGPEADKYR | Fibrinogen gamma | Plasma | 1033.5193 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2862 | RLDGSVDFK | Fibrinogen gamma | Plasma | 1035.5349 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2863 | TSEVKQLIK | Fibrinogen gamma | Plasma | 1044.6179 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2864 | TTMKIIPFN | Fibrinogen gamma | Plasma | 1063.5736 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2865 | VELEDWNGR | Fibrinogen gamma | Plasma | 1116.52 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2866 | TSTADYAMFK | Fibrinogen gamma | Plasma | 1133.5063 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2867 | FFTSHNGMQF | Fibrinogen gamma | Plasma | 1214.5179 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2868 | TIGEGQQHHLGGA | Fibrinogen gamma | Plasma | 1303.6269 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2869 | LTIGEGQQHHLGGA | Fibrinogen gamma | Plasma | 1416.711 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2870 | IHLISTQSAIPYAL | Fibrinogen gamma | Plasma | 1525.8504 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2871 | NGYDNGIIWATWK | Fibrinogen gamma | Plasma | 1536.7361 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2872 | LTIGEGQQHHLGGAK | Fibrinogen gamma | Plasma | 1544.8059 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2873 | RLTIGEGQQHHLGGA | Fibrinogen gamma | Plasma | 1572.8121 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2874 | PDESSKPNMIDAATL | Fibrinogen gamma | Plasma | 1587.745 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2875 | PDESSKPNMIDAATLK | Fibrinogen gamma | Plasma | 1715.84 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2876 | TPNGYDNGIIWATWK | Fibrinogen gamma | Plasma | 1734.8366 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2877 | ASTPNGYDNGIIWATW | Fibrinogen gamma | Plasma | 1764.8108 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2878 | STPNGYDNGIIWATWK | Fibrinogen gamma | Plasma | 1821.8686 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2879 | ASTPNGYDNGIIWATWK | Fibrinogen gamma | Plasma | 1892.9057 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2880 | IPFNRLTIGEGQQHHLGGA | Fibrinogen gamma | Plasma | 2044.0603 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2881 | EGFGHLSPTGTTEFWLGNE | Fibrinogen gamma | Plasma | 2077.9381 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2882 | VELEDWNGRTSTADYAMF | Fibrinogen gamma | Plasma | 2103.9208 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2883 | IIPFNRLTIGEGQQHHLGGA | Fibrinogen gamma | Plasma | 2157.1443 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2884 | EGFGHLSPTGTTEFWLGNEK | Fibrinogen gamma | Plasma | 2206.0331 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2885 | AIQLTYNPDESSKPNMIDAATL | Fibrinogen gamma | Plasma | 2391.1628 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2886 | AIQLTYNPDESSKPNMIDAATLK | Fibrinogen gamma | Plasma | 2519.2578 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2887 | AIQLTYNPDESSKPNMIDAATLK + OXIDATION (M) | Fibrinogen gamma | Plasma | 2535.2527 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2888 | TTMKIIPFNRLTIGEGQQHHLGGA | Fibrinogen gamma | Plasma | 2618.3751 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2889 | IHLISTQSAIPYALRVELEDWNG | Fibrinogen gamma | Plasma | 2624.3598 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2890 | IHLISTQSAIPYALRVELEDWNGR | Fibrinogen gamma | Plasma | 2780.461 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2891 | LTYAYFAGGDAGDAFDGFDFGDDPSDK | Fibrinogen gamma | Plasma | 2833.1668 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2892 | QLIKAIQLTYNPDESSKPNMIDAATL | Fibrinogen gamma | Plasma | 2873.4845 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2893 | QLIKAIQLTYNPDESSKPNMIDAATLK | Fibrinogen gamma | Plasma | 3001.5794 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2894 | YRLTYAYFAGGDAGDAFDGFDFGDDPSDK | Fibrinogen gamma | Plasma | 3152.3312 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2895 | TSEVKQLIKAIQLTYNPDESSKPNMIDAATLK | Fibrinogen gamma | Plasma | 3545.8651 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2896 | EGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYAL | Fibrinogen gamma | Plasma | 3713.873 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2897 | IHLISTQSAIPYALRVELEDWNGRTSTADYAMF | Fibrinogen gamma | Plasma | 3767.8618 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2898 | VGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDK | Fibrinogen gamma | Plasma | 3848.6754 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID4756 | ELEDWNGRTSTADYA | Isoform Gamma-B of Fibrinogen gamma chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4757 | ELEDWNGRTSTADYAMF | Isoform Gamma-B of Fibrinogen gamma chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5131 | GGDAGDAFDGFDFGDDPSDKFFT | Isoform Gamma-B of Fibrinogen gamma chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5132 | GGDAGDAFDGFDFGDDPSDKFFTSHNGMQF | Isoform Gamma-B of Fibrinogen gamma chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5316 | GTTEFWLGNEKI | Isoform Gamma-B of Fibrinogen gamma chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6102 | LTYNPDESSKPNMI | Isoform Gamma-B of Fibrinogen gamma chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6555 | QLTYNPDESSKPNMI | Isoform Gamma-B of Fibrinogen gamma chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6556 | QLTYNPDESSKPNMIDAA | Isoform Gamma-B of Fibrinogen gamma chain | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8692 | AIQLTYNPDES | Isoform Gamma-B of Fibrinogen gamma chain | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8983 | IQLTYNPDES | Isoform Gamma-B of Fibrinogen gamma chain | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8984 | IQLTYNPDESSKPNMID | Isoform Gamma-B of Fibrinogen gamma chain | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9059 | LTYNPDESSKPNM | Isoform Gamma-B of Fibrinogen gamma chain | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9181 | QLTYNPDES | Isoform Gamma-B of Fibrinogen gamma chain | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9182 | QLTYNPDESSKPNMID | Isoform Gamma-B of Fibrinogen gamma chain | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9183 | QLTYNPDESSKPNMIDA | Isoform Gamma-B of Fibrinogen gamma chain | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9203 | QVRPEHPAETEYD | Isoform Gamma-B of Fibrinogen gamma chain | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9352 | TYNPDESSKPNMID | Isoform Gamma-B of Fibrinogen gamma chain | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9440 | YNPDESSKPNMID | Isoform Gamma-B of Fibrinogen gamma chain | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID10050 | FWLGNEKIHL | Fibrinogen gamma chain precursor | Urine | 1256.6718 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10060 | FDFGDDPSDKF | Fibrinogen gamma chain precursor | Urine | 1289.5288 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10224 | KVGPEADKYRLTYA | Fibrinogen gamma chain precursor | Urine | 1610.854 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10267 | FKVGPEADKYRLTY | Fibrinogen gamma chain precursor | Urine | 1686.8834 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10299 | FKVGPEADKYRLTYA | Fibrinogen gamma chain precursor | Urine | 1757.9242 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10381 | FKVGPEADKYRLTYAY | Fibrinogen gamma chain precursor | Urine | 1920.9709 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10594 | YFAGGDAGDAFDGFDFGDDPSDKF | Fibrinogen gamma chain precursor | Urine | 2533.0019 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10601 | FKKNWIQYKEGFGHLSPTGTTE | Fibrinogen gamma chain precursor | Urine | 2568.2859 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10610 | AYFAGGDAGDAFDGFDFGDDPSDKF | Fibrinogen gamma chain precursor | Urine | 2604.0364 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |