Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID4580 | DGNASGTTLLEALDCILPPTRPTDKPL | Elongation factor 1-alpha | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4581 | DGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVY | Elongation factor 1-alpha | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5137 | GGIGTVPVGRVETGVLKPGM | Elongation factor 1-alpha | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5138 | GGIGTVPVGRVETGVLKPGMVV | Elongation factor 1-alpha | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5464 | IGGIGTVPVGRVETGVLKPGM | Elongation factor 1-alpha | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5465 | IGGIGTVPVGRVETGVLKPGMVV | Elongation factor 1-alpha | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7855 | VIILNHPGQISAG | Elongation factor 1-alpha | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8693 | AIVDMVPGKPMCVES | Elongation factor 1-alpha 1 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9394 | VNKMDSTEPPYS | Elongation factor 1-alpha 1 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID13182 | STEPPYSQK | Elongation factor 1-alpha 1 | Plasma | 1036.495 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |
| CancerPDF_ID13567 | IGGIGTVPVGR | Elongation factor 1-alpha 1 | Plasma | 1025.611 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |
| CancerPDF_ID13987 | TTTGHLIYK | Elongation factor 1-alpha 1 | Plasma | 1033.568 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |
| CancerPDF_ID14037 | STTTGHLIYK | Elongation factor 1-alpha 1 | Plasma | 1120.6 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |