Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
---|---|---|---|---|---|---|---|---|
CancerPDF_ID6175 | MENANVLARYA | Fructose-bisphosphate aldolase A | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID7378 | TFLSGGQSEEEASINLNAINKCPLLKPWALTF | Fructose-bisphosphate aldolase A | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
CancerPDF_ID10702 | PYQYPALTPEQKKELSDIAHRIVAPGKGIL | Fructose-bisphosphate aldolase A | Urine | 3332.8627 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
CancerPDF_ID11237 | ALSDHHIYL | Fructose-bisphosphate aldolase A | Serum | 1067.54 | LC-MS | Melanoma | "Present in 8 cancer samples out of 8 cancer samples. ,Present in 3 healthy samples out of 4 healthy samples." | 26992070 |
CancerPDF_ID11533 | GTYVSSVPR | "HLA class II histocompatibility antigen, DO alpha chain" | Serum | 964.49779 | LC-MS | Melanoma | "Present in 3 cancer samples out of 8 cancer samples. ,Present in 2 healthy samples out of 4 healthy samples." | 26992070 |
CancerPDF_ID12986 | GRALQASAL | Fructose-bisphosphate aldolase A | Plasma | 886.511 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |
CancerPDF_ID13070 | GTYVSSVPR | "HLA class II histocompatibility antigen, DO alpha chain" | Plasma | 965.506 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |
CancerPDF_ID13404 | VPPAVTGITF | Fructose-bisphosphate aldolase A | Plasma | 1001.567 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |
CancerPDF_ID13990 | SLFVSNHAY | Fructose-bisphosphate aldolase A | Plasma | 1037.506 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |