Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID4104 | ADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGS | Neutrophil defensin 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4354 | ARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGS | Neutrophil defensin 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4458 | CIYQGRLWAF | Neutrophil defensin 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4564 | DEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGS | Neutrophil defensin 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5704 | LAWDESLAPK | Neutrophil defensin 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6001 | LQARADEVAAAPEQIAADIPEVVVSLAWDESLAPK | Neutrophil defensin 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6002 | LQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPG | Neutrophil defensin 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6486 | QARADEVAAAPEQIAADIPEVVVSLAWDESLAPK | Neutrophil defensin 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6487 | QARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGS | Neutrophil defensin 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8327 | YQGRLWAFCC | Neutrophil defensin 1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID13778 | IYQGRLWAF | Neutrophil defensin 1 | Plasma | 1153.616 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |