Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID4419 | AVSDGVIKVF | Cofilin-1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4520 | CLSEDKKNIILEEGKEILVGDVGQTVDDPYATFV | Cofilin-1 | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8873 | GKEILVGDVGQTVDDPY | Cofilin-1 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8874 | GKEILVGDVGQTVDDPYATF | Cofilin-1 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9064 | LYDATYETKE | Cofilin-1 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9148 | QANCYEEVKDRC | Cofilin-1 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9149 | QANCYEEVKDRCT | Cofilin-1 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9379 | VLFCLSEDK | Cofilin-1 | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID12167 | SEDKKNIIL | Cofilin-1 | Serum | 1058.5972 | LC-MS | Melanoma | "Present in 3 cancer samples out of 8 cancer samples. ,Present in 0 healthy samples out of 4 healthy samples." | 26992070 |